Gene Information

Name : ECENHK_02785 (ECENHK_02785)
Accession : YP_006577074.1
Strain : Enterobacter cloacae ENHKU01
Genome accession: NC_018405
Putative virulence/resistance : Virulence
Product : phage transcriptional regulator AlpA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 604317 - 604523 bp
Length : 207 bp
Strand : -
Note : COG3311 Predicted transcriptional regulator

DNA sequence :
ATGACCACAGATTACAGCGTACTTAACGACCAATTAGTGACGATGACGTTTATTACCCAGCTCACCGGTTTAACCGACAA
ATGGTTCTACAAGCTCATTAAAGACGGTGAGTTCCCAAAGCCCATTAAGCTGGGCAGAAGCTCCCGCTGGCTTGAAAGCG
AAGTGGAGGCCTGGCTACAGCAACGCATTGCACAGTCCCGTCCGTAA

Protein sequence :
MTTDYSVLNDQLVTMTFITQLTGLTDKWFYKLIKDGEFPKPIKLGRSSRWLESEVEAWLQQRIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 1e-22 83
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 6e-22 80
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 6e-22 80
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 5e-22 80
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 4e-22 80
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 3e-22 80
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 3e-22 80
unnamed AAL08466.1 unknown Not tested SRL Protein 6e-22 77
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 5e-18 70
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-18 70
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 3e-14 68
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 3e-14 68

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECENHK_02785 YP_006577074.1 phage transcriptional regulator AlpA VFG0651 Protein 2e-22 80
ECENHK_02785 YP_006577074.1 phage transcriptional regulator AlpA VFG1057 Protein 2e-22 77
ECENHK_02785 YP_006577074.1 phage transcriptional regulator AlpA VFG1480 Protein 2e-18 70