Gene Information

Name : BN69_1502 (BN69_1502)
Accession : YP_006591604.1
Strain : Methylocystis sp. SC2
Genome accession: NC_018485
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1568630 - 1569313 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
TTGCGGCTGCTCGTCGTTGAGGACGACAAGGATTTGAACCGCCAGATCGTTCGCGCGCTTGAACAATCGGGCTATGCGGT
GGACCGCGCTTTCGATGGCGAGGAAGGTTGCCATCTCGGCGAAACGGAGCCCTACGACGCCGTCGTCCTCGACATCGGTC
TGCCGAAGAAGGACGGCGTGACCGTTCTCGAAGAATGGCGCGCGGCGGGACGCGACATGCCGGTGCTGATCCTCACCGCG
CGCGACCGCTGGAGCGACAAGGTGCAAGGCTTCGACGCCGGCGCCGACGACTATGTTTCAAAACCCTTCCACATGGAGGA
GGTGCTGGCGCGCATCCGCGCCCTGCTGCGCCGCGCGACGGGCCATGCGACGAATGAAATCGTCTGCGGCGCGGTGCGGC
TCGACACCAAGGCCGGCCGCGTCGTCGTGGACGGCGCGCCGGTGAAGCTCACCTCGCACGAATACCGGCTGCTCGCCTAT
CTGATGCATCACAGCGGACGCGTCGTATCCCGCAGCGAAATCATCGAGCATCTATACGATCAGGACTTTGACCGCGACTC
GAACACGATCGAAGTCTTCGTCGGCAGGTTGCGCAAAAAGCTTGGCGTCGATCTGATCCAGACCGTGCGCGGGCTGGGCT
ACATGGCGGCCGCGCCGGCAAAGGACGCCGGCTATAAACGCTAG

Protein sequence :
MRLLVVEDDKDLNRQIVRALEQSGYAVDRAFDGEEGCHLGETEPYDAVVLDIGLPKKDGVTVLEEWRAAGRDMPVLILTA
RDRWSDKVQGFDAGADDYVSKPFHMEEVLARIRALLRRATGHATNEIVCGAVRLDTKAGRVVVDGAPVKLTSHEYRLLAY
LMHHSGRVVSRSEIIEHLYDQDFDRDSNTIEVFVGRLRKKLGVDLIQTVRGLGYMAAAPAKDAGYKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-30 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 2e-37 47
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family CP000647.1.gene1136. Protein 2e-34 45
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family BAC0530 Protein 2e-34 45
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family CP001918.1.gene2526. Protein 5e-33 43
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family CP001138.1.gene1939. Protein 2e-34 43
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family BAC0487 Protein 9e-30 43
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family BAC0347 Protein 5e-26 41
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family NC_002695.1.913289.p Protein 4e-33 41
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family CP000034.1.gene2022. Protein 8e-34 41
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family BAC0111 Protein 3e-31 41
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family VFG0475 Protein 2e-34 43
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family VFG1390 Protein 7e-29 43
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family VFG0473 Protein 6e-27 42
BN69_1502 YP_006591604.1 two component transcriptional regulator, winged helix family VFG1389 Protein 9e-27 41