Gene Information

Name : BN69_2410 (BN69_2410)
Accession : YP_006592512.1
Strain : Methylocystis sp. SC2
Genome accession: NC_018485
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator PhoB, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2473909 - 2474655 bp
Length : 747 bp
Strand : +
Note : -

DNA sequence :
ATGAGTGACGTGACGTCCGCCGTTTTACAGCGGAGCGGGAAAAGCGATCGGGCGCCGCGCATCCTCGTCGTCGAGGACGA
AACGTCGCTCGCGACGCTGCTCGTGTATAATCTCGAAGCTGAAGGCTATCAGGTCGAGCATGTCGACAATGGCGACGAAG
CCGAGCTGCGGCTCGCGGAGTCGCCGCCGGATCTCGTCATTCTCGACTGGATGCTGCCCGGCGTTTCCGGACTTGAAATC
TGCCGACGCCTGCGCGCGCGGGACAGCGCCAGAGACATGCCTGTCATCATGCTGACCGCGCGGGGCGAGGAAGGCGAGCG
CGTGCGCGGTCTTTCCGTCGGCGCCGACGACTATGTCGTCAAGCCGTTTTCGACTCCGGAGCTGATGGCGCGGGTGCGCG
CGCTGCTGCGCCGGGCGCGCCCCGAGCGCGTCGCCTCACGGCTGACTCTCGGCGATATCGACCTCGACCGCGACACCCGT
CGCGTGCGGCGATCCGCCCGCGAAATCCACCTCGGTCCGACCGAATTCCGGCTGCTCGAATATTTTATGGAGAAGCCCGG
ACGCGTGTTCACGCGCGCGCAGCTGCTCGACAGCGTTTGGGGCATGTCGGCGGAGATCGACGAGCGCACGGTCGACGTCC
ATGTCGGACGGCTCCGCAAGGCGCTGATCCGCGGCCGCGAGAAGGATCCGATCCGCACGGTCCGCGGCGCGGGCTATTCC
TTCGACGAAACCTTCGGACACGAGTGA

Protein sequence :
MSDVTSAVLQRSGKSDRAPRILVVEDETSLATLLVYNLEAEGYQVEHVDNGDEAELRLAESPPDLVILDWMLPGVSGLEI
CRRLRARDSARDMPVIMLTARGEEGERVRGLSVGADDYVVKPFSTPELMARVRALLRRARPERVASRLTLGDIDLDRDTR
RVRRSAREIHLGPTEFRLLEYFMEKPGRVFTRAQLLDSVWGMSAEIDERTVDVHVGRLRKALIRGREKDPIRTVRGAGYS
FDETFGHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-30 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-30 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_010410.6002989.p0 Protein 6e-29 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_010400.5986590.p0 Protein 4e-29 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_011595.7057856.p0 Protein 6e-29 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family BAC0347 Protein 7e-23 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family BAC0308 Protein 5e-22 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family BAC0111 Protein 3e-26 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_002952.2859905.p0 Protein 3e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_002745.1124361.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_009782.5559369.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_002951.3237708.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_003923.1003749.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_002758.1121668.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_007622.3794472.p0 Protein 3e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_009641.5332272.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_013450.8614421.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family NC_007793.3914279.p0 Protein 4e-33 42
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family HE999704.1.gene1528. Protein 2e-24 41
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family BAC0197 Protein 4e-20 41
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family AE000516.2.gene3505. Protein 6e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family VFG1390 Protein 3e-26 45
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family VFG1563 Protein 4e-30 44
BN69_2410 YP_006592512.1 two component transcriptional regulator PhoB, winged helix family VFG1702 Protein 2e-30 44