Gene Information

Name : BCK_05285 (BCK_05285)
Accession : YP_006595166.1
Strain : Bacillus cereus FRI-35
Genome accession: NC_018491
Putative virulence/resistance : Virulence
Product : Response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1011414 - 1012085 bp
Length : 672 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGCGCTTACTCGTAGTAGAAGATAATGCTTCTTTATTAGAGTCCATTGTCCAAATATTATGCGATGAATTTGAAGTAGA
TACAGCATTGAATGGAGAAGATGGATTATTTCTAGCATTACAAAATATATATGACGCTATTTTACTTGATGTGATGATGC
CAGAAATGGACGGTTTTGAAGTAATTCAAAAAATACGTGATGAAAAGATTGAAACACCTGTCTTATTTTTGACAGCGAGA
GATTCTTTAGAAGATCGCGTGAAAGGGTTGGATTTTGGCGGGGATGACTATATCGTTAAGCCGTTTCAGGCCCCAGAATT
AAAAGCAAGAATTCGTGCTTTATTAAGGCGAAGTGGTAGTTTAACAACGAAGCAGACTATTCGATATAAAGGGATTGAAC
TGTTCGGAAAAGATAAAGATGTTCAAGTAGATGGACAAAGTATGAAGCTAACATTAAAACAATATGAGCTTTTAGAGTAC
CTTGTTCAAAATAGCGGAAAGATTTTAATGCGTGAACAAATTTTTGATCGTGTTTGGGGATTTGATTCAGATACGACAGT
GGCAATTGTAGAAGTGTATGTACATCATTTACGTAAAAAATTAGAGCCATTCGGTTATCAGAAAGATATTCAAACCGTTC
GAGGTATTGGATATATATTAAAAGAACAATGA

Protein sequence :
MRLLVVEDNASLLESIVQILCDEFEVDTALNGEDGLFLALQNIYDAILLDVMMPEMDGFEVIQKIRDEKIETPVLFLTAR
DSLEDRVKGLDFGGDDYIVKPFQAPELKARIRALLRRSGSLTTKQTIRYKGIELFGKDKDVQVDGQSMKLTLKQYELLEY
LVQNSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_05285 YP_006595166.1 Response regulator BAC0125 Protein 4e-36 45
BCK_05285 YP_006595166.1 Response regulator AE015929.1.gene1106. Protein 4e-36 43
BCK_05285 YP_006595166.1 Response regulator BAC0638 Protein 7e-34 43
BCK_05285 YP_006595166.1 Response regulator NC_007622.3794948.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator NC_003923.1003417.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator NC_013450.8614146.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator NC_002951.3238224.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator NC_007793.3914065.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator NC_002758.1121390.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator NC_010079.5776364.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator NC_002952.2859858.p0 Protein 8e-41 42
BCK_05285 YP_006595166.1 Response regulator BAC0308 Protein 1e-32 41
BCK_05285 YP_006595166.1 Response regulator BAC0197 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_05285 YP_006595166.1 Response regulator VFG0596 Protein 4e-35 43
BCK_05285 YP_006595166.1 Response regulator VFG1386 Protein 3e-41 43
BCK_05285 YP_006595166.1 Response regulator VFG1390 Protein 5e-39 42
BCK_05285 YP_006595166.1 Response regulator VFG1389 Protein 1e-36 41