Gene Information

Name : BCK_07960 (BCK_07960)
Accession : YP_006595701.1
Strain : Bacillus cereus FRI-35
Genome accession: NC_018491
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1601866 - 1602570 bp
Length : 705 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGGAAAGAAAATTTTAGTAGTTGATGATGAAAAGCCGATTGCAGATATTTTGAAGTTCAACCTAGAAAAAGAAGGTTT
TGAAATTGTAATGGCGCATGATGGTGATGAAGCAATTGAAAAAGCAACTGAAGAACAACCAGATATGGTTTTATTAGATA
TTATGCTACCAGGTAAGGATGGCTTAGAGGTTTGCCGTGAAATACGTAAAAGCTCAGAAATGCCGATTATTATGCTTACA
GCGAAGGACTCTGAAATCGATAAAGTATTAGGACTTGAGCTTGGGGCAGATGATTATGTAACGAAGCCATTTAGTACGAG
GGAATTACTTGCTCGCGTGAAGGCGAATTTACGTCGCCATCAGCAAGGTGGTGCGGCAGAAAAAGAAGAAAATACGGAAA
TGGTTATTGGACCAATTGTTATCAATCCAAATGCGTATAGTGTAACGAAACGTGAGGAAAATATTGAGCTTACACACCGT
GAATTTGAGCTATTACATTATTTAGCAAAACATTTAGGACAAGTTATGACACGTGAACATTTATTGCAAACAGTTTGGGG
TTATGACTATTTTGGAGATGTACGTACAGTGGATGTAACAGTACGTCGTCTACGTGAAAAAATCGAAGATAATCCAAGTC
ATCCTACATTAATTGTCACTAGACGTGGAGTAGGGTATTACTTGCGTGACCCAGAGCAGGAATAG

Protein sequence :
MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKATEEQPDMVLLDIMLPGKDGLEVCREIRKSSEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQQGGAAEKEENTEMVIGPIVINPNAYSVTKREENIELTHR
EFELLHYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPTLIVTRRGVGYYLRDPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_012469.1.7685629. Protein 3e-64 67
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 6e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 4e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 5e-57 56
BCK_07960 YP_006595701.1 DNA-binding response regulator HE999704.1.gene2815. Protein 4e-48 51
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_012469.1.7686381. Protein 3e-45 50
BCK_07960 YP_006595701.1 DNA-binding response regulator AE016830.1.gene1681. Protein 1e-48 48
BCK_07960 YP_006595701.1 DNA-binding response regulator CP004022.1.gene3215. Protein 9e-36 48
BCK_07960 YP_006595701.1 DNA-binding response regulator AE000516.2.gene3505. Protein 5e-39 46
BCK_07960 YP_006595701.1 DNA-binding response regulator HE999704.1.gene1528. Protein 4e-32 45
BCK_07960 YP_006595701.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 2e-38 45
BCK_07960 YP_006595701.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 7e-40 45
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002695.1.915041.p Protein 8e-34 44
BCK_07960 YP_006595701.1 DNA-binding response regulator CP000647.1.gene4257. Protein 9e-33 44
BCK_07960 YP_006595701.1 DNA-binding response regulator CP001138.1.gene4273. Protein 8e-33 44
BCK_07960 YP_006595701.1 DNA-binding response regulator CP000034.1.gene3834. Protein 8e-34 44
BCK_07960 YP_006595701.1 DNA-binding response regulator BAC0533 Protein 9e-33 44
BCK_07960 YP_006595701.1 DNA-binding response regulator AF162694.1.orf4.gene Protein 3e-34 43
BCK_07960 YP_006595701.1 DNA-binding response regulator AM180355.1.gene1830. Protein 2e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 6e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator BAC0125 Protein 2e-31 42
BCK_07960 YP_006595701.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 4e-36 42
BCK_07960 YP_006595701.1 DNA-binding response regulator CP004022.1.gene1676. Protein 1e-31 42
BCK_07960 YP_006595701.1 DNA-binding response regulator AF130997.1.orf0.gene Protein 9e-35 41
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 6e-39 41
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 6e-39 41
BCK_07960 YP_006595701.1 DNA-binding response regulator AE015929.1.gene1106. Protein 2e-32 41
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_011595.7057856.p0 Protein 3e-32 41
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_010410.6002989.p0 Protein 3e-32 41
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_010400.5986590.p0 Protein 2e-31 41
BCK_07960 YP_006595701.1 DNA-binding response regulator BAC0039 Protein 9e-34 41
BCK_07960 YP_006595701.1 DNA-binding response regulator CP000034.1.gene2186. Protein 9e-34 41
BCK_07960 YP_006595701.1 DNA-binding response regulator NC_002695.1.916589.p Protein 7e-34 41
BCK_07960 YP_006595701.1 DNA-binding response regulator CP001918.1.gene3444. Protein 8e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_07960 YP_006595701.1 DNA-binding response regulator VFG1563 Protein 9e-38 43
BCK_07960 YP_006595701.1 DNA-binding response regulator VFG1702 Protein 2e-37 43
BCK_07960 YP_006595701.1 DNA-binding response regulator VFG1390 Protein 1e-38 42
BCK_07960 YP_006595701.1 DNA-binding response regulator VFG1386 Protein 5e-35 42
BCK_07960 YP_006595701.1 DNA-binding response regulator VFG1389 Protein 3e-31 42