Gene Information

Name : BCK_21610 (BCK_21610)
Accession : YP_006598408.1
Strain : Bacillus cereus FRI-35
Genome accession: NC_018491
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4204411 - 4205085 bp
Length : 675 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
TTGCAACGCATATTAATTATTGAGGATGAGGAAAGTTTAGCTGATTTTTTAGAATTAGAATTAAAGTATGAAGGATATAA
GGTAGACATTCAGTTTGATGGAAGGAAGGGATTAGAGGCCGCGCTTGAAACAAATTATGATCTTATTTTACTTGATTTAA
TGCTGCCTGGGTTAAATGGACTAGAAGTGTGTCGTAGATTAAGGGCAACTAAAAATACACCTATTATTATGTTGACTGCA
CGCGATAGTATTATGGATCGTGTGACAGGATTAGATAGCGGAGCTGATGATTATCTTCCGAAACCATTTGCAATTGAAGA
GCTTTTAGCGCGAATGAGAGTTATATTTAGACGAGAAGAACATATAGAAAACAAACATGTTTCATCTCTTACGTTCAAAG
ATTTACAGCTCCAGATTGAATCGCGAACGATTACGAAAGGAAATGAAGAAATCGAACTAACAAATAAAGAATTTGAACTA
TTACTAATGTTCATGAAAAATGTTAATAGAGTACTTACCCGTGATGTTTTATTAGATCAAGTATGGGGATATGACGCGAT
GGTTGAGACAAATATCGTTGATGTATACGTTCGTTATTTACGTAACAAGTTACATAGTGTAGATAAGGAGGAATATATCC
AAACGGTCCGCGGTGCTGGATATATAATGAAATGA

Protein sequence :
MQRILIIEDEESLADFLELELKYEGYKVDIQFDGRKGLEAALETNYDLILLDLMLPGLNGLEVCRRLRATKNTPIIMLTA
RDSIMDRVTGLDSGADDYLPKPFAIEELLARMRVIFRREEHIENKHVSSLTFKDLQLQIESRTITKGNEEIELTNKEFEL
LLMFMKNVNRVLTRDVLLDQVWGYDAMVETNIVDVYVRYLRNKLHSVDKEEYIQTVRGAGYIMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-30 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_21610 YP_006598408.1 DNA-binding response regulator HE999704.1.gene1528. Protein 2e-53 61
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 3e-48 52
BCK_21610 YP_006598408.1 DNA-binding response regulator AE015929.1.gene1106. Protein 1e-42 51
BCK_21610 YP_006598408.1 DNA-binding response regulator BAC0125 Protein 7e-33 44
BCK_21610 YP_006598408.1 DNA-binding response regulator AE016830.1.gene1681. Protein 2e-35 44
BCK_21610 YP_006598408.1 DNA-binding response regulator AE000516.2.gene3505. Protein 1e-31 44
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_012469.1.7686381. Protein 1e-31 43
BCK_21610 YP_006598408.1 DNA-binding response regulator BAC0197 Protein 4e-30 43
BCK_21610 YP_006598408.1 DNA-binding response regulator BAC0308 Protein 5e-30 42
BCK_21610 YP_006598408.1 DNA-binding response regulator BAC0083 Protein 2e-32 42
BCK_21610 YP_006598408.1 DNA-binding response regulator BAC0111 Protein 8e-30 42
BCK_21610 YP_006598408.1 DNA-binding response regulator HE999704.1.gene2815. Protein 3e-30 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 9e-32 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 9e-32 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 1e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator CP001485.1.gene721.p Protein 6e-25 41
BCK_21610 YP_006598408.1 DNA-binding response regulator NC_012469.1.7685629. Protein 2e-32 41
BCK_21610 YP_006598408.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCK_21610 YP_006598408.1 DNA-binding response regulator VFG1390 Protein 1e-43 46
BCK_21610 YP_006598408.1 DNA-binding response regulator VFG0596 Protein 5e-31 42
BCK_21610 YP_006598408.1 DNA-binding response regulator VFG0473 Protein 2e-23 41
BCK_21610 YP_006598408.1 DNA-binding response regulator VFG1386 Protein 8e-36 41