Gene Information

Name : BTG_06080 (BTG_06080)
Accession : YP_006602741.1
Strain : Bacillus thuringiensis HD-771
Genome accession: NC_018500
Putative virulence/resistance : Resistance
Product : two-component response regulator VanRB
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1193010 - 1193675 bp
Length : 666 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAAACTATCATATTCTCGTGGTAGAGGACGATCAAGAAATTCAGGAATTAATTAAACAATTTTTAATGACACAGCA
TTATACAGTGGTAGTCGCTTCAGATGGACTAGAGGGTATGACACAATTTAATAAGCAATCCTTTGATTTAATTCTCCTAG
ATGTCATGATGCCCAATCTTAATGGGTTTGAAGTTTCTAAAATGATTCGAAGTCAGTCAAACGTACCAATTATTATGCTA
ACTGCGTTGGAAGAAGAGGAAGATCAAATGAAAGGATTCGATCTTGGGATCGATGATTATATAACAAAACCCTTTTCATT
TCATGTTTTGATTAGACGAGTCGAAGCTGTACTTAGAAGAAGTTATGATAAAAATGTAAATAATCATTTGATATTTAAAG
AAGTTCGTATCGATGTGGATGCATATAGAGTCTATGTAAATGATGTTGAAATTATATTAACGACAAAAGAGTTTGAAATT
CTACAACTACTATTTCAAAATGAGAGAAAAGTACTTACAAGAGAAAATATCGTAGAGAAGGTTTGGGGGTACGATTATTT
TGGAGAAACACGAATAATTGATACACATATTAAAAACCTACGCAAAAAATTAGCTATCCCTTATATTAAAACAATAAAGG
GTATTGGTTATAAAATTGATGAATAG

Protein sequence :
MKNYHILVVEDDQEIQELIKQFLMTQHYTVVVASDGLEGMTQFNKQSFDLILLDVMMPNLNGFEVSKMIRSQSNVPIIML
TALEEEEDQMKGFDLGIDDYITKPFSFHVLIRRVEAVLRRSYDKNVNNHLIFKEVRIDVDAYRVYVNDVEIILTTKEFEI
LQLLFQNERKVLTRENIVEKVWGYDYFGETRIIDTHIKNLRKKLAIPYIKTIKGIGYKIDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 5e-56 63
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-41 43
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTG_06080 YP_006602741.1 two-component response regulator VanRB HE999704.1.gene1202. Protein 1e-46 46
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_002952.2859905.p0 Protein 2e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_002745.1124361.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_009782.5559369.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_002951.3237708.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_002758.1121668.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_009641.5332272.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_013450.8614421.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_007793.3914279.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_003923.1003749.p0 Protein 3e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_007622.3794472.p0 Protein 2e-36 44
BTG_06080 YP_006602741.1 two-component response regulator VanRB U35369.1.gene1.p01 Protein 1e-41 43
BTG_06080 YP_006602741.1 two-component response regulator VanRB AE016830.1.gene2255. Protein 1e-41 43
BTG_06080 YP_006602741.1 two-component response regulator VanRB AF310956.2.orf0.gene Protein 5e-40 42
BTG_06080 YP_006602741.1 two-component response regulator VanRB AE015929.1.gene1106. Protein 1e-28 42
BTG_06080 YP_006602741.1 two-component response regulator VanRB FJ349556.1.orf0.gene Protein 2e-33 42
BTG_06080 YP_006602741.1 two-component response regulator VanRB AF155139.2.orf0.gene Protein 4e-32 42
BTG_06080 YP_006602741.1 two-component response regulator VanRB NC_012469.1.7685629. Protein 1e-34 41
BTG_06080 YP_006602741.1 two-component response regulator VanRB HE999704.1.gene2815. Protein 1e-33 41