Gene Information

Name : BTG_18860 (BTG_18860)
Accession : YP_006605233.1
Strain : Bacillus thuringiensis HD-771
Genome accession: NC_018500
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3690776 - 3691354 bp
Length : 579 bp
Strand : -
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGTTATTCAATTACAAAAAGGACAGAAAATTGATTTGGGTAAGACAAGCCCTGGTTTAACAAAAGCAGTAATTGGTCT
TGGATGGGATATTAAATCTTATGACGGTGGATCAGATTTCGATTTAGATGCATCTGCCTTTTTATTAGATGCAAACGGAA
AATGTACGAAGGAAACTGATTTTATCTTCTATAATAATTTACAGTCTCCTTGTGGATCTGTTTTACATACAGGAGATAAC
CGTACAGGTGAAGGTGAAGGTGACGATGAGCAACTTGTTGTGGACTTAAAGAAAGTTCCAGCAGATGTGCACAGAATTGC
TATTACAGTTACGATTTATGATGCAGAAGGCCGTAGTCAAAACTTTGGACAAGTAGGAAATGCGTTTGTTCGTTTAGCAA
ATGAAGAGACGAATGAAGAAGTTCTTCGTTTTGATTTAGGGGAAGATTTCTCCATCGAAACAGCAGTTGTCTTTTGTGAA
TTATACCGTCATAATGGACAGTGGAAGTTTAATGCAGTAGGAAGTGGATTCCAAGGTGGTTTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAG

Protein sequence :
MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGSDFDLDASAFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLVVDLKKVPADVHRIAITVTIYDAEGRSQNFGQVGNAFVRLANEETNEEVLRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-44 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-44 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-44 57
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-48 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-42 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-42 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-42 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-40 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTG_18860 YP_006605233.1 tellurium resistance protein BAC0389 Protein 2e-44 59
BTG_18860 YP_006605233.1 tellurium resistance protein BAC0390 Protein 3e-43 53