Gene Information

Name : BTG_20990 (BTG_20990)
Accession : YP_006605649.1
Strain : Bacillus thuringiensis HD-771
Genome accession: NC_018500
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator YycF
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4150412 - 4151116 bp
Length : 705 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGGGAAAGAAAATTTTAGTAGTTGATGATGAAAAGCCGATTGCAGATATTTTGAAGTTTAATCTAGAAAAAGAAGGTTT
TGAAATAGTAATGGCGCATGATGGTGATGAAGCAATTGAAAAAGCTAATGAAGAACAACCAGATATGGTTTTATTAGATA
TTATGCTACCGGGTAAAGATGGATTAGAGGTTTGCCGTGAAATACGTAAAAGTTCAGAAATGCCGATTATTATGCTTACA
GCAAAGGACTCTGAGATTGATAAAGTATTAGGGCTTGAGCTTGGGGCAGATGATTATGTAACGAAGCCATTTAGTACGAG
GGAATTACTTGCTCGTGTGAAGGCGAATTTACGCCGTCATCAACAAGGTGGTTCTGCAGAAAAAGAAGAAAATACAGAAA
TGGTTATTGGACCAATTGTTATTAATCCAAATGCATATAGTGTAACGAAGCGCGAGGAAAATATCGAGCTTACACATCGT
GAATTTGAGTTGCTACATTATTTAGCGAAACATTTAGGACAAGTTATGACACGCGAACATTTATTACAAACAGTTTGGGG
TTATGACTATTTTGGAGATGTGCGCACAGTAGACGTAACAGTACGTCGTTTGCGTGAAAAAATTGAAGATAATCCAAGCC
ATCCTACTTTAATTGTAACTAGACGTGGAGTAGGGTATTACTTGCGTGACCCAGAGCAGGAATAG

Protein sequence :
MGKKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEEQPDMVLLDIMLPGKDGLEVCREIRKSSEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQQGGSAEKEENTEMVIGPIVINPNAYSVTKREENIELTHR
EFELLHYLAKHLGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPTLIVTRRGVGYYLRDPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_012469.1.7685629. Protein 3e-64 67
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002951.3237708.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_003923.1003749.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002758.1121668.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_009641.5332272.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_013450.8614421.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_007793.3914279.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002952.2859905.p0 Protein 5e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_007622.3794472.p0 Protein 2e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002745.1124361.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_009782.5559369.p0 Protein 3e-57 56
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF HE999704.1.gene2815. Protein 5e-48 51
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_012469.1.7686381. Protein 2e-45 50
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF AE016830.1.gene1681. Protein 1e-48 48
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF CP004022.1.gene3215. Protein 1e-35 48
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF AE000516.2.gene3505. Protein 4e-39 46
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF HE999704.1.gene1528. Protein 7e-32 45
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF AF155139.2.orf0.gene Protein 1e-38 45
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF FJ349556.1.orf0.gene Protein 4e-40 45
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF CP000034.1.gene3834. Protein 8e-34 44
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF BAC0533 Protein 9e-33 44
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002695.1.915041.p Protein 8e-34 44
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF CP000647.1.gene4257. Protein 9e-33 44
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF CP001138.1.gene4273. Protein 9e-33 44
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF AM180355.1.gene1830. Protein 9e-38 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_007793.3914065.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002758.1121390.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_010079.5776364.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002952.2859858.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_007622.3794948.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_003923.1003417.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_013450.8614146.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002951.3238224.p0 Protein 1e-36 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF BAC0125 Protein 2e-31 42
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF AF162694.1.orf4.gene Protein 2e-34 42
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF DQ212986.1.gene4.p01 Protein 2e-36 42
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF CP004022.1.gene1676. Protein 8e-32 42
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF AF130997.1.orf0.gene Protein 7e-35 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_005054.2598277.p0 Protein 4e-39 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_014475.1.orf0.gen Protein 4e-39 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF AE015929.1.gene1106. Protein 4e-32 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_011595.7057856.p0 Protein 2e-32 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_010400.5986590.p0 Protein 1e-31 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_010410.6002989.p0 Protein 2e-32 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF CP000034.1.gene2186. Protein 8e-34 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF NC_002695.1.916589.p Protein 6e-34 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF CP001918.1.gene3444. Protein 6e-33 41
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF BAC0039 Protein 8e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF VFG1563 Protein 6e-38 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF VFG1702 Protein 1e-37 43
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF VFG1390 Protein 2e-38 42
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF VFG1386 Protein 3e-35 42
BTG_20990 YP_006605649.1 DNA-binding response regulator YycF VFG1389 Protein 5e-31 42