Gene Information

Name : GEM_0116 (GEM_0116)
Accession : YP_006614271.1
Strain :
Genome accession: NC_018513
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 127067 - 127498 bp
Length : 432 bp
Strand : -
Note : -

DNA sequence :
ATGAAGATCGGCGAACTGGCCAAGGCGGCCCGCTGCACGCCCGAAACGATCCGCTTCTACGAGAAGGAGGGGCTGATGCC
GGACGCGGAGCGCACCGATTCGAACTACCGCAACTACACCGACGTGCACGTCGAACGACTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGACGAAATCCGCGCGCTGCTGCAGCTCACCGACACGCCAGCCGATCCATGCGATTCGATC
AACGCGCTGCTCGACGAACACATCGGCCACGTCGATGCGCGCCTCGCCGAACTGACCCATCTGCGCGACCAGCTCACCGA
ATTGCGCCGCCAGTGCGTCGGTGAACATTCGGTCGAGGACTGCGGAATCGTGCACGGTCTCGCGACGATGGAAACCGTCG
CGCCGGCCGCGAAACGTTCGCACCTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDVHVERLRFIRNCRALDMAHDEIRALLQLTDTPADPCDSI
NALLDEHIGHVDARLAELTHLRDQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 6e-32 50
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 8e-30 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 5e-30 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 8e-30 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 5e-30 46
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-29 45
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-29 45
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-29 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GEM_0116 YP_006614271.1 MerR family transcriptional regulator BAC0058 Protein 3e-39 57
GEM_0116 YP_006614271.1 MerR family transcriptional regulator BAC0301 Protein 4e-31 53