Gene Information

Name : GEM_5279 (GEM_5279)
Accession : YP_006619358.1
Strain :
Genome accession: NC_018514
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2329166 - 2329837 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGGATACTGATAGTCGAAGACGAACCCAAGATGGCGTCGTACCTCCGCAAGGGGCTGACGGAGGCGAGCTACACGGT
CGACGTGGCCGAGAACGGCCGGGACGGGCTGTTCCTCGCACTGCACGAGGATTTCGATCTCGTCGTGCTCGACGTGATGC
TGCCGGAACTGGACGGCTTCGAGGTGCTGCGGCGGCTGCGCGCGCAGAAGCAGACGCCGGTGCTGCTGCTCACGGCCCGC
GAGGCGATCGAAGACAAGGTCACGGGGCTCGAACTGGGCGCCGACGACTACCTGCTCAAGCCGTTCGCGTATGCGGAATT
CCTCGCCCGCATCCGCTCGCTGTTGCGGCGCGCGCCGCGCAATGCGCGCGAGATCCTGCATGTCGCCGATCTCGAAGTCG
ACCTGATCAAGCGCCGCGTGCGGCGTGCCGACAACCGCATCGACCTGACCGCGCAGGAGTTCGCGCTGCTGCAACTGCTC
GCGGAACGCGAGGGCGAGGTGCTCACGCGCACCTTCATCACGTCGCAGATCTGGGACATGAATTTCGACAGCGACACGAA
CGTCGTCGATGCGGCGATCAAGCGCCTGCGCGCGAAGATCGACAACGCCTATGAGAAGAAGCTGATCCACACGATTCGCG
GGATGGGCTACGTGCTCGAGGATCGCTCGTGA

Protein sequence :
MRILIVEDEPKMASYLRKGLTEASYTVDVAENGRDGLFLALHEDFDLVVLDVMLPELDGFEVLRRLRAQKQTPVLLLTAR
EAIEDKVTGLELGADDYLLKPFAYAEFLARIRSLLRRAPRNAREILHVADLEVDLIKRRVRRADNRIDLTAQEFALLQLL
AEREGEVLTRTFITSQIWDMNFDSDTNVVDAAIKRLRAKIDNAYEKKLIHTIRGMGYVLEDRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-52 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-51 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family BAC0197 Protein 8e-58 63
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family BAC0638 Protein 5e-58 61
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family BAC0083 Protein 1e-57 59
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family BAC0111 Protein 2e-56 59
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family BAC0125 Protein 6e-58 58
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family BAC0308 Protein 5e-53 56
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family BAC0347 Protein 4e-50 56
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-34 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-32 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-29 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family VFG0596 Protein 2e-52 55
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family VFG1390 Protein 1e-35 44
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family VFG1386 Protein 3e-33 43
GEM_5279 YP_006619358.1 two component heavy metal response transcriptional regulator, winged helix family VFG1389 Protein 3e-29 43