Gene Information

Name : Desmer_1162 (Desmer_1162)
Accession : YP_006621050.1
Strain : Desulfosporosinus meridiei DSM 13257
Genome accession: NC_018515
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1203463 - 1204044 bp
Length : 582 bp
Strand : +
Note : PFAM: Bacterial stress protein

DNA sequence :
GTGGGGATCAGTCTGCAAAAAGGACAAAAGATTGACTTAACTAAGGGAAACCCAGGGCTAACCAAGATCATTGTTGGATT
AGGCTGGGATACCAATAAGTATTCCGGTGGGTCGGACTTTGACCTAGATGCCTCCGTATTCTTGCTTGACAAAAACGGTC
GAGCCGGAGGAATTGAGGATTTTATATATTATAATAACCTCGTTGGAGGTAATGGTTCAGTAAAACATACCGGTGATAAC
CTCACCGGAGCAGGTGACGGGGATGATGAACAAATTAAGGTTGACTTAGCTCTTGTACCTGCCCATGTCGAAAAGATTGC
CTTTACCGTTACAATTCATGACGCGGTTCAAAGATCCCAGAACTTTGGTCAAGTATCAAATTCCTTTGTCCGAGTTGTTA
ATGAAACCAATGGACAAGAAGTTATGCGCTACGATTTAGGTGAAGATTTTTCTGTTGAAACAGCACTTGTAGTTTGCGAA
TTATATCGTCACCAAGGAGAATGGAAGTTTAATGCTATTGGCAGTGGCTTCTCAGGAGGACTGGCTGCTCTTTGCACAAA
CTATGGGTTAGATGTAAATTAG

Protein sequence :
MGISLQKGQKIDLTKGNPGLTKIIVGLGWDTNKYSGGSDFDLDASVFLLDKNGRAGGIEDFIYYNNLVGGNGSVKHTGDN
LTGAGDGDDEQIKVDLALVPAHVEKIAFTVTIHDAVQRSQNFGQVSNSFVRVVNETNGQEVMRYDLGEDFSVETALVVCE
LYRHQGEWKFNAIGSGFSGGLAALCTNYGLDVN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-58 64
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 6e-54 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-46 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 54
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 54
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-47 53
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-29 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desmer_1162 YP_006621050.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 2e-50 56
Desmer_1162 YP_006621050.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 3e-53 56
Desmer_1162 YP_006621050.1 stress response protein, TerZ- and CABP1 BAC0392 Protein 9e-25 41