Gene Information

Name : Desmer_1530 (Desmer_1530)
Accession : YP_006621394.1
Strain : Desulfosporosinus meridiei DSM 13257
Genome accession: NC_018515
Putative virulence/resistance : Resistance
Product : copper chaperone
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1606653 - 1606853 bp
Length : 201 bp
Strand : +
Note : PFAM: Heavy-metal-associated domain

DNA sequence :
ATGAGTCAAACTATTCTAAAGGTTGAAGGGATGACCTGCAACCACTGTAAAATGAGAGCAGAAAAAGCTTTACAGGCAGT
GAGTGGTGTAGAAAGCGTAAAAGTTGATCTTGCGGCTAAGGAAGCGGTTGTAACTGGTGAGGCTAAGCGCGAGAATTTGG
TTAAAGCAATCGTAGATGCTGGGTATACTGTCGTTGAATAA

Protein sequence :
MSQTILKVEGMTCNHCKMRAEKALQAVSGVESVKVDLAAKEAVVTGEAKRENLVKAIVDAGYTVVE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-06 44
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-06 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-06 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-06 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-06 44
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-06 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desmer_1530 YP_006621394.1 copper chaperone BAC0675 Protein 6e-06 43
Desmer_1530 YP_006621394.1 copper chaperone BAC0231 Protein 1e-06 43
Desmer_1530 YP_006621394.1 copper chaperone BAC0678 Protein 1e-06 41