Gene Information

Name : yycF (ARUE_c14870)
Accession : YP_006661441.1
Strain : Arthrobacter sp. Rue61a
Genome accession: NC_018531
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YycF
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1620430 - 1621197 bp
Length : 768 bp
Strand : +
Note : -

DNA sequence :
GTGACCACAAATACGGCATCATCTGCACCGGGGAATCGTCGCATTCTTCTGGTAGAGGATGAACAGACCATTGCCGACGT
TGTCCGCGACTACCTGCTGAAGGCCGGGTTCCAAGTGGACATGGCGGGGGACGGCTTCACCGCGCTCGAGCTGGCAGCCT
CTCGTCAACCCGACCTTGTGATCCTGGACCGCATGCTGCCAGGACTGGACGGTGTGGAGGTCTGCCGCCGACTCCGCCAA
ACCATGAGCGTTCCCGTCATCATGGTCACGGCTCTGGGAACCGAAGACGACCGGATTCTGGGCTTGGAAATGGGAGCGGA
TGATTACGTCACCAAACCCTTCTCTCCGCGGGAGCTGGTCCTCCGGGTTAAATCGGTACTGCGCCGGAGCATCAAGGAAT
TCGCGCCGGAACCGCCTGTGGAGGCCGCAGGACTTGAACTGGATCCTGCCTCCCGGACAGTCACGCACGGCGGAGTTCCG
CTGGCGCTGACGGTCCGTGAATTCGACCTCCTGGCTTTCATGATGCGAAGGCCCAACCAAGTTTTCAGCCGGGAAGAATT
GATCAAGGCCGTCTGGGGCTGGGACTTCGGCGATCTGTCCACAGTCACGGTCCACGTCCGGCGCCTGCGGGAGAAAATCG
AAGCCAACCCCACCAAACCCGAACTGCTCAAGACCGTATGGGGCGTCGGCTACCGCTTCGACAGCAAGCGATCCGATGGC
GTCACTATGAACGTGCACGGCAAAGAGGGTGAGCATGGAAGGCAGTGA

Protein sequence :
MTTNTASSAPGNRRILLVEDEQTIADVVRDYLLKAGFQVDMAGDGFTALELAASRQPDLVILDRMLPGLDGVEVCRRLRQ
TMSVPVIMVTALGTEDDRILGLEMGADDYVTKPFSPRELVLRVKSVLRRSIKEFAPEPPVEAAGLELDPASRTVTHGGVP
LALTVREFDLLAFMMRRPNQVFSREELIKAVWGWDFGDLSTVTVHVRRLREKIEANPTKPELLKTVWGVGYRFDSKRSDG
VTMNVHGKEGEHGRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_012469.1.7685629. Protein 3e-44 48
yycF YP_006661441.1 transcriptional regulatory protein YycF AE000516.2.gene3505. Protein 3e-39 46
yycF YP_006661441.1 transcriptional regulatory protein YycF HE999704.1.gene2815. Protein 8e-44 45
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_002758.1121668.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_009641.5332272.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_013450.8614421.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_002952.2859905.p0 Protein 2e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_007793.3914279.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_003923.1003749.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_002745.1124361.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_009782.5559369.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_002951.3237708.p0 Protein 1e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_007622.3794472.p0 Protein 2e-45 44
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_012469.1.7686381. Protein 1e-44 44
yycF YP_006661441.1 transcriptional regulatory protein YycF BAC0197 Protein 1e-32 43
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_011595.7057856.p0 Protein 1e-37 43
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_010410.6002989.p0 Protein 1e-37 43
yycF YP_006661441.1 transcriptional regulatory protein YycF AF162694.1.orf4.gene Protein 2e-34 43
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_010400.5986590.p0 Protein 7e-37 42
yycF YP_006661441.1 transcriptional regulatory protein YycF BAC0347 Protein 1e-34 42
yycF YP_006661441.1 transcriptional regulatory protein YycF AF130997.1.orf0.gene Protein 1e-33 42
yycF YP_006661441.1 transcriptional regulatory protein YycF AF155139.2.orf0.gene Protein 1e-39 42
yycF YP_006661441.1 transcriptional regulatory protein YycF FJ349556.1.orf0.gene Protein 2e-38 42
yycF YP_006661441.1 transcriptional regulatory protein YycF CP000675.2.gene1535. Protein 8e-39 41
yycF YP_006661441.1 transcriptional regulatory protein YycF AE016830.1.gene1681. Protein 4e-42 41
yycF YP_006661441.1 transcriptional regulatory protein YycF EU250284.1.orf4.gene Protein 4e-34 41
yycF YP_006661441.1 transcriptional regulatory protein YycF BAC0111 Protein 5e-37 41
yycF YP_006661441.1 transcriptional regulatory protein YycF HE999704.1.gene1528. Protein 4e-29 41
yycF YP_006661441.1 transcriptional regulatory protein YycF BAC0638 Protein 4e-25 41
yycF YP_006661441.1 transcriptional regulatory protein YycF NC_009085.4919120.p0 Protein 7e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006661441.1 transcriptional regulatory protein YycF VFG1389 Protein 3e-29 44
yycF YP_006661441.1 transcriptional regulatory protein YycF VFG1563 Protein 2e-38 43
yycF YP_006661441.1 transcriptional regulatory protein YycF VFG0596 Protein 6e-35 42
yycF YP_006661441.1 transcriptional regulatory protein YycF VFG1702 Protein 7e-38 42
yycF YP_006661441.1 transcriptional regulatory protein YycF VFG1390 Protein 2e-35 42