Gene Information

Name : phoP (LMOSLCC2540_2534)
Accession : YP_006680077.1
Strain : Listeria monocytogenes SLCC2540
Genome accession: NC_018586
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2595098 - 2595808 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
TTGGTAAAAATTCTTGTAGTTGATGATGAAGCTTCTATTGTTACGTTACTGCAATTTAACATTGAAAAAGCTGGGTTTGG
TGTGGTAACAGCAGAAGACGGCAGAACCGGATACGAACTCGCTTTGTCCGAAAAACCAGATTTAATTGTGCTTGATTTAA
TGCTTCCTGAGATGGACGGAATCGAAGTAACAAAAAAACTTCGCCAAGATAAAGTAAATGTGCCAATTTTAATGTTAACG
GCAAAAGATGAAGAATTAGATAAAATTATCGGACTGGAACTTGGAGCAGATGACTATATGACTAAACCGTTTAGCCCAAG
AGAAGTAGTTGCAAGAATTAAAGCAATCTTGCGTCGAACAGAAGGAAAAGCCGAAATAATAGAAGAAATAACCGAAGATT
CGGAAGCTACGATATTAATTGGTGATTTGAAAATTTTGCCAGATAGTTATGAAGTGTATTTACAAGATGATTTACTTGAT
TTAACGCCAAAAGAATTTGAGTTATTGCTATTCTTGGCAAATCATCGTGGCAAAGTTTTCTCTAGAGACCAATTGCTCGA
TACTGTCTGGAACTATGATTACGTTGGAGAAACCCGAATTGTAGACGTTCATGTCAGCCATTTGCGCGATAAAATCGAAC
TAGATACAAAACAACCTAAATACATCAAAACAATTCGTGGCTTCGGTTATAAAATGGAGAACGTGAAATAA

Protein sequence :
MVKILVVDDEASIVTLLQFNIEKAGFGVVTAEDGRTGYELALSEKPDLIVLDLMLPEMDGIEVTKKLRQDKVNVPILMLT
AKDEELDKIIGLELGADDYMTKPFSPREVVARIKAILRRTEGKAEIIEEITEDSEATILIGDLKILPDSYEVYLQDDLLD
LTPKEFELLLFLANHRGKVFSRDQLLDTVWNYDYVGETRIVDVHVSHLRDKIELDTKQPKYIKTIRGFGYKMENVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-41 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-41 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_006680077.1 two-component response regulator HE999704.1.gene2815. Protein 7e-106 99
phoP YP_006680077.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-67 60
phoP YP_006680077.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-67 59
phoP YP_006680077.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-67 59
phoP YP_006680077.1 two-component response regulator AE016830.1.gene1681. Protein 4e-69 56
phoP YP_006680077.1 two-component response regulator NC_012469.1.7685629. Protein 2e-55 54
phoP YP_006680077.1 two-component response regulator NC_012469.1.7686381. Protein 1e-60 50
phoP YP_006680077.1 two-component response regulator AF162694.1.orf4.gene Protein 1e-37 43
phoP YP_006680077.1 two-component response regulator AE000516.2.gene3505. Protein 5e-38 43
phoP YP_006680077.1 two-component response regulator CP001485.1.gene721.p Protein 5e-36 42
phoP YP_006680077.1 two-component response regulator CP001918.1.gene5135. Protein 4e-29 42
phoP YP_006680077.1 two-component response regulator CP004022.1.gene3215. Protein 1e-36 41
phoP YP_006680077.1 two-component response regulator EU250284.1.orf4.gene Protein 9e-39 41
phoP YP_006680077.1 two-component response regulator BAC0533 Protein 1e-32 41
phoP YP_006680077.1 two-component response regulator NC_002695.1.915041.p Protein 4e-32 41
phoP YP_006680077.1 two-component response regulator CP000647.1.gene4257. Protein 1e-32 41
phoP YP_006680077.1 two-component response regulator CP000034.1.gene3834. Protein 4e-32 41
phoP YP_006680077.1 two-component response regulator CP001138.1.gene4273. Protein 1e-32 41
phoP YP_006680077.1 two-component response regulator CP000034.1.gene3671. Protein 4e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_006680077.1 two-component response regulator VFG1563 Protein 2e-41 42
phoP YP_006680077.1 two-component response regulator VFG1702 Protein 2e-41 42
phoP YP_006680077.1 two-component response regulator VFG1386 Protein 6e-39 41
phoP YP_006680077.1 two-component response regulator VFG1389 Protein 9e-33 41