Gene Information

Name : phoP (LMOSLCC7179_2412)
Accession : YP_006700105.1
Strain : Listeria monocytogenes SLCC7179
Genome accession: NC_018593
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2477486 - 2478196 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
TTGGTAAAAATTCTTGTAGTTGATGATGAAGCTTCTATTGTTACCTTGCTACAATTTAATATTGAAAAAGCAGGATTTGA
AGTGGTGACAGCTGAAGATGGTAAAACTGGGTATGAGCTCGCTTTGTCCGAAAAGCCAGATTTAATTGTGCTTGATTTAA
TGCTTCCTGAGATGGACGGAATCGAAGTAACAAAAAAACTTCGTCAAGATAAAGTAAATGTACCAATTTTAATGTTAACA
GCAAAAGATGAAGAGTTAGATAAAATTATTGGACTTGAACTTGGAGCAGATGATTATATGACTAAGCCTTTTAGTCCAAG
AGAAGTAGTGGCGAGAATTAAAGCTATCCTGCGTCGAACAGAAGGAAAAGCAGAAATAATAGAAGAATTAACCGAAGATG
TGGAAGCCGCTATATTAATTGGTGATTTGAAAATTTTGCCAGATAGTTACGAAGTGTATTTACAAGATGATTTACTTGAC
CTAACACCGAAAGAATTTGAGTTGTTATTATTCCTGGCGAATCATCGTGGCAAAGTTTTCTCTAGAGACCAATTGCTCGA
TACTGTCTGGAACTATGATTACGTTGGCGAAACCCGAATTGTAGACGTTCATGTTAGCCATTTGCGCGATAAAATCGAAC
TAGATACGAAACAACCTAAATATATCAAAACAATTCGTGGCTTCGGTTATAAAATGGAGAACGTAAAATAA

Protein sequence :
MVKILVVDDEASIVTLLQFNIEKAGFEVVTAEDGKTGYELALSEKPDLIVLDLMLPEMDGIEVTKKLRQDKVNVPILMLT
AKDEELDKIIGLELGADDYMTKPFSPREVVARIKAILRRTEGKAEIIEELTEDVEAAILIGDLKILPDSYEVYLQDDLLD
LTPKEFELLLFLANHRGKVFSRDQLLDTVWNYDYVGETRIVDVHVSHLRDKIELDTKQPKYIKTIRGFGYKMENVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-42 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-42 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_006700105.1 two-component response regulator HE999704.1.gene2815. Protein 1e-106 99
phoP YP_006700105.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-68 61
phoP YP_006700105.1 two-component response regulator NC_002952.2859905.p0 Protein 3e-68 60
phoP YP_006700105.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-68 60
phoP YP_006700105.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-68 60
phoP YP_006700105.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-68 60
phoP YP_006700105.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-68 60
phoP YP_006700105.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-68 60
phoP YP_006700105.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-68 60
phoP YP_006700105.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-68 60
phoP YP_006700105.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-68 60
phoP YP_006700105.1 two-component response regulator AE016830.1.gene1681. Protein 8e-70 58
phoP YP_006700105.1 two-component response regulator NC_012469.1.7685629. Protein 5e-55 54
phoP YP_006700105.1 two-component response regulator NC_012469.1.7686381. Protein 9e-60 49
phoP YP_006700105.1 two-component response regulator CP001485.1.gene721.p Protein 1e-36 43
phoP YP_006700105.1 two-component response regulator AF162694.1.orf4.gene Protein 2e-37 43
phoP YP_006700105.1 two-component response regulator AE000516.2.gene3505. Protein 4e-38 43
phoP YP_006700105.1 two-component response regulator CP004022.1.gene3215. Protein 3e-36 41
phoP YP_006700105.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-39 41
phoP YP_006700105.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-39 41
phoP YP_006700105.1 two-component response regulator EU250284.1.orf4.gene Protein 6e-39 41
phoP YP_006700105.1 two-component response regulator CP001138.1.gene4273. Protein 3e-32 41
phoP YP_006700105.1 two-component response regulator BAC0533 Protein 3e-32 41
phoP YP_006700105.1 two-component response regulator NC_002695.1.915041.p Protein 9e-32 41
phoP YP_006700105.1 two-component response regulator CP000647.1.gene4257. Protein 3e-32 41
phoP YP_006700105.1 two-component response regulator CP000034.1.gene3834. Protein 9e-32 41
phoP YP_006700105.1 two-component response regulator AM180355.1.gene1830. Protein 3e-38 41
phoP YP_006700105.1 two-component response regulator CP001918.1.gene5135. Protein 1e-28 41
phoP YP_006700105.1 two-component response regulator CP001918.1.gene3444. Protein 2e-34 41
phoP YP_006700105.1 two-component response regulator CP000034.1.gene3671. Protein 3e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_006700105.1 two-component response regulator VFG1702 Protein 4e-42 43
phoP YP_006700105.1 two-component response regulator VFG1563 Protein 5e-42 42
phoP YP_006700105.1 two-component response regulator VFG1386 Protein 4e-39 42
phoP YP_006700105.1 two-component response regulator VFG1389 Protein 5e-33 41