Gene Information

Name : yycF (C248_0021)
Accession : YP_006708783.1
Strain : Staphylococcus aureus 08BA02176
Genome accession: NC_018608
Putative virulence/resistance : Virulence
Product : response regulator protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 25049 - 25750 bp
Length : 702 bp
Strand : +
Note : -

DNA sequence :
ATGGCTAGAAAAGTTGTTGTAGTTGATGATGAAAAACCGATTGCTGATATTTTAGAATTTAATTTAAAAAAAGAAGGATA
CGATGTGTACTGTGCATACGATGGTAATGATGCAGTCGACTTAATTTATGAAGAAGAACCAGACATCGTATTGCTAGATA
TCATGTTACCTGGTCGTGATGGTATGGAAGTATGTCGTGAAGTGCGCAAAAAATACGAAATGCCAATTATAATGCTTACT
GCTAAAGATTCAGAAATTGATAAAGTGCTTGGTTTAGAACTAGGTGCAGATGACTATGTAACGAAACCGTTTAGTACGCG
TGAATTAATCGCACGTGTGAAAGCGAACTTACGTCGTCATTACTCACAACCAGCACAAGACACTGGAAATGTAACGAATG
AAATCACAATTAAAGATATTGTGATTTATCCAGACGCATATTCTATTAAAAAGCGTGGCGAAGATATTGAATTAACACAT
CGTGAATTTGAATTGTTCCATTATTTATCAAAACATATGGGACAAGTAATGACACGTGAACATTTATTACAAACAGTATG
GGGCTATGATTACTTTGGCGATGTACGTACGGTCGATGTAACGATTCGTCGTTTACGTGAAAAGATTGAAGATGATCCGT
CACATCCTGAATACATTGTGACGCGTAGAGGCGTTGGATATTTCCTCCAACAACATGAGTAG

Protein sequence :
MARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTH
REFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006708783.1 response regulator protein NC_012469.1.7685629. Protein 2e-70 63
yycF YP_006708783.1 response regulator protein NC_003923.1003749.p0 Protein 2e-56 53
yycF YP_006708783.1 response regulator protein NC_002952.2859905.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_013450.8614421.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_007793.3914279.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_002745.1124361.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_009782.5559369.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_002951.3237708.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_002758.1121668.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_007622.3794472.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein NC_009641.5332272.p0 Protein 2e-56 52
yycF YP_006708783.1 response regulator protein HE999704.1.gene2815. Protein 7e-52 50
yycF YP_006708783.1 response regulator protein NC_012469.1.7686381. Protein 4e-47 49
yycF YP_006708783.1 response regulator protein AE016830.1.gene1681. Protein 3e-48 46
yycF YP_006708783.1 response regulator protein AE000516.2.gene3505. Protein 9e-42 46
yycF YP_006708783.1 response regulator protein AM180355.1.gene1830. Protein 2e-45 45
yycF YP_006708783.1 response regulator protein NC_005054.2598277.p0 Protein 3e-42 44
yycF YP_006708783.1 response regulator protein AF130997.1.orf0.gene Protein 1e-41 44
yycF YP_006708783.1 response regulator protein NC_014475.1.orf0.gen Protein 3e-42 44
yycF YP_006708783.1 response regulator protein FJ349556.1.orf0.gene Protein 6e-41 44
yycF YP_006708783.1 response regulator protein AF155139.2.orf0.gene Protein 2e-38 43
yycF YP_006708783.1 response regulator protein DQ212986.1.gene4.p01 Protein 1e-41 42
yycF YP_006708783.1 response regulator protein NC_003923.1003417.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein NC_013450.8614146.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein NC_002951.3238224.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein NC_007793.3914065.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein NC_002758.1121390.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein NC_010079.5776364.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein NC_002952.2859858.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein NC_007622.3794948.p0 Protein 6e-36 41
yycF YP_006708783.1 response regulator protein HE999704.1.gene1528. Protein 4e-35 41
yycF YP_006708783.1 response regulator protein AF162694.1.orf4.gene Protein 6e-37 41
yycF YP_006708783.1 response regulator protein CP001918.1.gene5135. Protein 9e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006708783.1 response regulator protein VFG1702 Protein 4e-37 41
yycF YP_006708783.1 response regulator protein VFG1563 Protein 6e-37 41