Gene Information

Name : C269_01450 (C269_01450)
Accession : YP_006744623.1
Strain : Leuconostoc gelidum JB7
Genome accession: NC_018631
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 305525 - 306232 bp
Length : 708 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGTAAAATTTTGGTTGTGGATGATGAGAAGCCAATCTCAGATATCATTAAATTTAATTTAACCAAAGAAGGATATGA
AGTGGTAACCGCAGCTGATGGTCAGGAAGCGTTGACAGTGTTCAATGAAGAAAAGCCTGATCTTGTTTTGCTTGACCAAA
TGTTGCCTGAAATTGATGGTGTTGAAGTGTTGCGTCAAATTCGTTCAAAATCAGAAACACCAGTTATTATGGTGACAGCT
AAAGATTCTGAAATTGACAAAGTGTTAGGTTTAGAAATGGGTGCTGACGATTATGTTACAAAACCGTTCTCAAATCGTGA
ATTAGTAGCACGTGTTAAGGCTAATTTACGTAGCCGTAAAGCTGTTGCACAACATATTGATGAGTCTGTTGTGAATACTG
ATGACATCGAGTTAGGTGATTTGACAATACACCCACAAGCATATATGGTGTCAAAGGCTGGCCAAGATATTGAATTAACG
CATCGTGAATTCGAACTGCTTTATTATTTAGCACAACATATTAGTCAAGTGATGACACGTGAACATTTATTGCAACAGGT
TTGGGGCTATGACTATTTCGGGGATGTCCGAACGGTAGACGTTACTGTTCGCCGTTTGCGTGAAAAAATTGAAGATAATC
CAAGTCACCCTAATTGGTTGGCAACGCGTCGTGGGGTAGGATATTATTTGCGTCCTGACGCAGAGTAA

Protein sequence :
MSKILVVDDEKPISDIIKFNLTKEGYEVVTAADGQEALTVFNEEKPDLVLLDQMLPEIDGVEVLRQIRSKSETPVIMVTA
KDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLRSRKAVAQHIDESVVNTDDIELGDLTIHPQAYMVSKAGQDIELT
HREFELLYYLAQHISQVMTREHLLQQVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWLATRRGVGYYLRPDAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C269_01450 YP_006744623.1 two-component response regulator NC_012469.1.7685629. Protein 2e-68 67
C269_01450 YP_006744623.1 two-component response regulator NC_013450.8614421.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_007793.3914279.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_007622.3794472.p0 Protein 3e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_002745.1124361.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_009782.5559369.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_002951.3237708.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_003923.1003749.p0 Protein 3e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_002758.1121668.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_009641.5332272.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-47 51
C269_01450 YP_006744623.1 two-component response regulator HE999704.1.gene2815. Protein 1e-47 50
C269_01450 YP_006744623.1 two-component response regulator NC_012469.1.7686381. Protein 3e-42 48
C269_01450 YP_006744623.1 two-component response regulator AE016830.1.gene1681. Protein 1e-42 45
C269_01450 YP_006744623.1 two-component response regulator AE000516.2.gene3505. Protein 2e-35 45
C269_01450 YP_006744623.1 two-component response regulator NC_002695.1.915041.p Protein 1e-33 44
C269_01450 YP_006744623.1 two-component response regulator CP000034.1.gene3834. Protein 1e-33 44
C269_01450 YP_006744623.1 two-component response regulator CP001138.1.gene4273. Protein 1e-33 44
C269_01450 YP_006744623.1 two-component response regulator AF155139.2.orf0.gene Protein 2e-37 44
C269_01450 YP_006744623.1 two-component response regulator BAC0533 Protein 7e-34 43
C269_01450 YP_006744623.1 two-component response regulator CP000647.1.gene4257. Protein 7e-34 43
C269_01450 YP_006744623.1 two-component response regulator CP001918.1.gene5135. Protein 6e-29 43
C269_01450 YP_006744623.1 two-component response regulator FJ349556.1.orf0.gene Protein 2e-38 43
C269_01450 YP_006744623.1 two-component response regulator NC_002952.2859858.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator NC_007622.3794948.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator NC_003923.1003417.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator NC_013450.8614146.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator NC_002951.3238224.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator NC_007793.3914065.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator NC_002758.1121390.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator NC_010079.5776364.p0 Protein 8e-35 43
C269_01450 YP_006744623.1 two-component response regulator CP004022.1.gene3215. Protein 1e-37 42
C269_01450 YP_006744623.1 two-component response regulator AE015929.1.gene1106. Protein 1e-30 42
C269_01450 YP_006744623.1 two-component response regulator HE999704.1.gene1528. Protein 1e-30 41
C269_01450 YP_006744623.1 two-component response regulator AF162694.1.orf4.gene Protein 4e-32 41
C269_01450 YP_006744623.1 two-component response regulator AM180355.1.gene1830. Protein 1e-36 41
C269_01450 YP_006744623.1 two-component response regulator NC_011586.7046392.p0 Protein 7e-23 41
C269_01450 YP_006744623.1 two-component response regulator NC_010410.6002907.p0 Protein 7e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C269_01450 YP_006744623.1 two-component response regulator VFG1389 Protein 7e-32 44
C269_01450 YP_006744623.1 two-component response regulator VFG1563 Protein 7e-34 42
C269_01450 YP_006744623.1 two-component response regulator VFG1702 Protein 9e-34 42
C269_01450 YP_006744623.1 two-component response regulator VFG1386 Protein 3e-31 41