Gene Information

Name : TOL2_C04010 (TOL2_C04010)
Accession : YP_006759275.1
Strain : Desulfobacula toluolica Tol2
Genome accession: NC_018645
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 484355 - 485086 bp
Length : 732 bp
Strand : -
Note : -

DNA sequence :
ATGGAAGAGATAAAAAAAACAATTCTGCTTGTGGAAGATGACTTGAGATTATCCCGGCTTGTCAGGGAATATCTGGAAAA
GCAGGGTTATGAAATCCTTTTGGAACACCACGGGGCTCTGGCTGGGGATCGAATTCTGGGTGAAGATCCGGATCTGGTTA
TCCTTGATCTCATGCTTCCGGGAAAGGATGGTTTATCAATCTGTAGGGATGTCAGGGCAAATTATCAGGGCCCTATTCTC
ATTCTTACTGCCAAGGAAGATGACATGGACCAGGTGGCAGGTCTGGAACTGGGTGCTGATGATTATGTAAAAAAACCTGT
GGAACCGAGGGTTCTGCTTGCAAGGATAAGGGCCTTGTTTCGGAGATCCAGCCATGTACCCATGGAATCTAAAAACTCTA
TTGAGAAAAAGCTTCAATTTGGTTCCCTGGAGATTAACCCGGCATCCAGGAGTGTAAAACTGGCCCATAAAGTAATTGAG
CTTTCCACCACAGAGTTTGACCTTTTATGTCTCTTGGCACTGAAATCAGGCAAAGTTCTGGACAGGGAGTTTTTATATCA
ATCTGTCAAAGGTATAGAATATGATGGTATAGACCGTTCAATGGATGTTGCCATATCTCGACTTAGAAAAAAACTAAAAG
ACAACCCGGAACATCCCTTCAGGATAAAGACTGTTTGGGGAAGCGGTTATCTCTTTGTTGATGATGCCTGGGACTATAAG
CCTGCCCCATGA

Protein sequence :
MEEIKKTILLVEDDLRLSRLVREYLEKQGYEILLEHHGALAGDRILGEDPDLVILDLMLPGKDGLSICRDVRANYQGPIL
ILTAKEDDMDQVAGLELGADDYVKKPVEPRVLLARIRALFRRSSHVPMESKNSIEKKLQFGSLEINPASRSVKLAHKVIE
LSTTEFDLLCLLALKSGKVLDREFLYQSVKGIEYDGIDRSMDVAISRLRKKLKDNPEHPFRIKTVWGSGYLFVDDAWDYK
PAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TOL2_C04010 YP_006759275.1 two component system response regulator NC_002952.2859905.p0 Protein 4e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_002745.1124361.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_009782.5559369.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_002951.3237708.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_003923.1003749.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_002758.1121668.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_009641.5332272.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_013450.8614421.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_007793.3914279.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator NC_007622.3794472.p0 Protein 3e-37 43
TOL2_C04010 YP_006759275.1 two component system response regulator FJ349556.1.orf0.gene Protein 1e-35 42
TOL2_C04010 YP_006759275.1 two component system response regulator NC_012469.1.7685629. Protein 9e-38 42
TOL2_C04010 YP_006759275.1 two component system response regulator CP000034.1.gene3671. Protein 3e-40 42
TOL2_C04010 YP_006759275.1 two component system response regulator NC_002951.3238224.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator NC_007793.3914065.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator NC_002758.1121390.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator NC_010079.5776364.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator NC_002952.2859858.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator NC_007622.3794948.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator NC_003923.1003417.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator NC_013450.8614146.p0 Protein 8e-28 41
TOL2_C04010 YP_006759275.1 two component system response regulator CP004022.1.gene3215. Protein 2e-38 41
TOL2_C04010 YP_006759275.1 two component system response regulator AF155139.2.orf0.gene Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TOL2_C04010 YP_006759275.1 two component system response regulator VFG1563 Protein 4e-33 42
TOL2_C04010 YP_006759275.1 two component system response regulator VFG1702 Protein 1e-32 42