Gene Information

Name : O3M_26422 (O3M_26422)
Accession : YP_006772832.1
Strain :
Genome accession: NC_018654
Putative virulence/resistance : Unknown
Product : IS66 transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 41755 - 42093 bp
Length : 339 bp
Strand : -
Note : COG3436 Transposase and inactivated derivatives

DNA sequence :
ATGATTTCACTCCCATCAGGTACCCGTATCTGGCTCGTTGCCGGCGTTACCGATATGCGTAAATCCTTCAATGGACTGGG
AGAACAGGTACAATATGTGCTGAATGATAATCCCTTCTCCGGTCACCTGTTTATCTTCCGTGGCCGACGGGGAGACACGA
TTAAAATCCTGTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGCCTTGAGGAAGGTCAGTTTATCTGGCCTGCG
GTGCGTGACGGTAAGATATCCATTACCCGCTCGCAACTGGCAATGCTCCTCGATAAGCTGGACTGGCGTCAGCCAAAACA
TCCCGCCTTAACGCACTGA

Protein sequence :
MISLPSGTRIWLVAGVTDMRKSFNGLGEQVQYVLNDNPFSGHLFIFRGRRGDTIKILWADADGLCLFTKRLEEGQFIWPA
VRDGKISITRSQLAMLLDKLDWRQPKHPALTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-45 94
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 1e-44 93
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-45 93
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-45 93
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 1e-44 93
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-38 69
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-38 69
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 4e-38 68
unnamed AAL08461.1 unknown Not tested SRL Protein 8e-35 67
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 1e-34 66
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-34 66
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-34 66
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-34 66
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-34 66
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-34 66
unnamed AAC31493.1 L0014 Not tested LEE Protein 1e-34 66
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 1e-34 66
unnamed AAL99258.1 unknown Not tested LEE Protein 1e-34 66
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-34 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-26 65
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-33 65
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-33 65
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-34 61
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-34 61
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 1e-27 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3M_26422 YP_006772832.1 IS66 transposase VFG1737 Protein 4e-46 94
O3M_26422 YP_006772832.1 IS66 transposase VFG1665 Protein 1e-38 68
O3M_26422 YP_006772832.1 IS66 transposase VFG1052 Protein 3e-35 67
O3M_26422 YP_006772832.1 IS66 transposase VFG1709 Protein 5e-35 66
O3M_26422 YP_006772832.1 IS66 transposase VFG0792 Protein 5e-35 66
O3M_26422 YP_006772832.1 IS66 transposase VFG1698 Protein 6e-35 66
O3M_26422 YP_006772832.1 IS66 transposase VFG1517 Protein 6e-27 65