
|
Name : O3O_25270 (O3O_25270) Accession : YP_006781876.1 Strain : Escherichia coli 2009EL-2071 Genome accession: NC_018661 Putative virulence/resistance : Virulence Product : Prophage CP4-57 regulatory protein Function : - COG functional category : - COG ID : - EC number : - Position : 62225 - 62431 bp Length : 207 bp Strand : - Note : COG3311 Predicted transcriptional regulator DNA sequence : ATGACCACCCCAGTTTCGCTGATGGATGACCAGATGGTCGATATGGCGTTTATCACTCAGCTGACCGGCCTGACCGATAA GTGGTTTTACAAGCTCATCAAGGATGGGGCCTTTCCGGCTCCCATCAAACTCGGCCGCAGCTCCCGCTGGCTGAAAAGTG AAGTGGAAGCCTGGCTACAGGCGCGTATTGCACAGTCCCGTCCGTAA Protein sequence : MTTPVSLMDDQMVDMAFITQLTGLTDKWFYKLIKDGAFPAPIKLGRSSRWLKSEVEAWLQARIAQSRP |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 6e-27 | 100 |
| unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 4e-26 | 96 |
| unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 4e-26 | 96 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 3e-26 | 95 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 7e-26 | 95 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-26 | 95 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-26 | 95 |
| unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 3e-26 | 95 |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-14 | 70 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-14 | 70 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 6e-18 | 70 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 8e-18 | 70 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| O3O_25270 | YP_006781876.1 | Prophage CP4-57 regulatory protein | VFG0651 | Protein | 1e-26 | 95 |
| O3O_25270 | YP_006781876.1 | Prophage CP4-57 regulatory protein | VFG1057 | Protein | 1e-26 | 95 |
| O3O_25270 | YP_006781876.1 | Prophage CP4-57 regulatory protein | VFG1480 | Protein | 2e-18 | 70 |