Gene Information

Name : arlR (Curi_c26090)
Accession : YP_006789451.1
Strain : Clostridium acidurici 9a
Genome accession: NC_018664
Putative virulence/resistance : Virulence
Product : two-component signal transduction response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2733830 - 2734519 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGTCTAAACAAAGAATTTTAATAATCGAAGATGAAATTAAAATTGCTAGATTTCTAGAATTAGAGTTAATATATGAAGG
ATACGAGGTTGAAAAAGCATATGATGGCAGAGAAGGACTTCAAAAGGTTATAAACGATAATTTTGACTTAATAATACTAG
ATATAATGTTACCTTCAATGAATGGAATGGAAGTGTTAAGGAAGGTTAGACAAACCTTAAACCTACCAATAATCATGTTA
ACAGCTAAAGATGAGACTATGGATAAAGTACTTGGTTTAGATATGGGAGCAGATGACTATGTAACTAAGCCATTTGCTAT
AGAGGAGCTCTTAGCTAGGATAAGAGTTGCATTGAAAAAAAGTTCGTCTAGGATTGTGGAAGTTAATACAAATATACTAC
AAGTGAAAGATCTTAAAGTAGATTTGAACACATATACTGTGACTTTTAAAGAAGATATAATAGATTTAACTAAGAAAGAA
TTTGATTTATTAAGCTATCTTATGAAAAATAAAAATATAGTTCTTACTCGAGAAAAAATATTGGATGAAGTATGGGAGTA
TGATTATGTAGGAGATACAAATATATCAGACGTATATATAAGATACTTAAGAAGTAAAATTGATGACAAATATAATGAAA
AATTTATCTATACTATTAGAGGGGTAGGCTATGTATTAAAAGATGAGTAG

Protein sequence :
MSKQRILIIEDEIKIARFLELELIYEGYEVEKAYDGREGLQKVINDNFDLIILDIMLPSMNGMEVLRKVRQTLNLPIIML
TAKDETMDKVLGLDMGADDYVTKPFAIEELLARIRVALKKSSSRIVEVNTNILQVKDLKVDLNTYTVTFKEDIIDLTKKE
FDLLSYLMKNKNIVLTREKILDEVWEYDYVGDTNISDVYIRYLRSKIDDKYNEKFIYTIRGVGYVLKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arlR YP_006789451.1 two-component signal transduction response regulator NC_010079.5776364.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator NC_002952.2859858.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator NC_007622.3794948.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator NC_003923.1003417.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator NC_013450.8614146.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator NC_002951.3238224.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator NC_007793.3914065.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator NC_002758.1121390.p0 Protein 6e-47 53
arlR YP_006789451.1 two-component signal transduction response regulator HE999704.1.gene1528. Protein 7e-43 53
arlR YP_006789451.1 two-component signal transduction response regulator AE015929.1.gene1106. Protein 9e-41 50
arlR YP_006789451.1 two-component signal transduction response regulator BAC0308 Protein 9e-36 45
arlR YP_006789451.1 two-component signal transduction response regulator HE999704.1.gene2815. Protein 2e-41 45
arlR YP_006789451.1 two-component signal transduction response regulator BAC0197 Protein 2e-39 44
arlR YP_006789451.1 two-component signal transduction response regulator BAC0125 Protein 5e-39 43
arlR YP_006789451.1 two-component signal transduction response regulator FJ349556.1.orf0.gene Protein 3e-31 43
arlR YP_006789451.1 two-component signal transduction response regulator BAC0111 Protein 2e-34 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_002952.2859905.p0 Protein 4e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_003923.1003749.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_002758.1121668.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_009641.5332272.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_013450.8614421.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_007793.3914279.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_007622.3794472.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_002745.1124361.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_009782.5559369.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_002951.3237708.p0 Protein 3e-38 43
arlR YP_006789451.1 two-component signal transduction response regulator NC_012469.1.7686381. Protein 4e-34 42
arlR YP_006789451.1 two-component signal transduction response regulator BAC0083 Protein 2e-37 42
arlR YP_006789451.1 two-component signal transduction response regulator NC_012469.1.7685629. Protein 4e-39 42
arlR YP_006789451.1 two-component signal transduction response regulator BAC0347 Protein 2e-31 42
arlR YP_006789451.1 two-component signal transduction response regulator AF155139.2.orf0.gene Protein 3e-27 42
arlR YP_006789451.1 two-component signal transduction response regulator BAC0638 Protein 7e-32 42
arlR YP_006789451.1 two-component signal transduction response regulator NC_014475.1.orf0.gen Protein 4e-30 41
arlR YP_006789451.1 two-component signal transduction response regulator NC_005054.2598277.p0 Protein 4e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
arlR YP_006789451.1 two-component signal transduction response regulator VFG1390 Protein 6e-40 43
arlR YP_006789451.1 two-component signal transduction response regulator VFG0596 Protein 1e-34 41