Gene Information

Name : Curi_c05260 (Curi_c05260)
Accession : YP_006787448.1
Strain : Clostridium acidurici 9a
Genome accession: NC_018664
Putative virulence/resistance : Resistance
Product : two-component system signal transduction response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 578522 - 579238 bp
Length : 717 bp
Strand : +
Note : -

DNA sequence :
ATGGAAACATCACTAAATAAGAAAAAGATATTAATAATAGATGATGAAGAGGATATACTGAAGTTATTATCTATGGTATT
AAAAAAAGAAGGTTTCGAAAATATATATACAGCTGAAGAAGCAGAAAGCGGACTTGATTTATTTGAAAGAGTTAATCCAG
ATATTATTCTTTTAGACATAATGCTACCTGACTCAGAAGGTTATGAAGTTTGTAAAAAAATTAGAAGAACATCTAATGTT
CCCATTCTATTTATATCAGCAAAAACTGAAGAGATTGATAGGGTGCTAGGATTTGCACTAGGTGGAGATGACTATATAAC
AAAGCCATTTAGTACTAAAGAGGTAGCCTATAGAATAAAAGCTCACTTAAGAAGAAGCAATTATAATGGTGAAGAAGAAA
ATAAAAGTACTATATTAAATTTTGGTCCTTTTCAAATAAATGAAGAGAAAATAGAAGTAAGGAAAAATGGAGAACTAATA
GATTTAAAACCAAAAGAATATAGAATGTTTTTATATATGGCAAAGCATCCTAATCAAATTATGAGTAAGGAGAAATTGTG
TAACGAAATATGGGGAGAAGACTATATAGGTTTTGATAACACCATAATGGTGCATATAAGAAGGTTAAGAGAGAAAGTTG
AAGAAGATCCATCTAAACCTAAATATATTATTAATGTAAAAGGTTTAGGATATAAGTTTGTTTTAAAGGATGAATAA

Protein sequence :
METSLNKKKILIIDDEEDILKLLSMVLKKEGFENIYTAEEAESGLDLFERVNPDIILLDIMLPDSEGYEVCKKIRRTSNV
PILFISAKTEEIDRVLGFALGGDDYITKPFSTKEVAYRIKAHLRRSNYNGEEENKSTILNFGPFQINEEKIEVRKNGELI
DLKPKEYRMFLYMAKHPNQIMSKEKLCNEIWGEDYIGFDNTIMVHIRRLREKVEEDPSKPKYIINVKGLGYKFVLKDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 7e-40 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_012469.1.7685629. Protein 9e-41 45
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator HE999704.1.gene2815. Protein 1e-39 44
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_012469.1.7686381. Protein 1e-39 43
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator FJ349556.1.orf0.gene Protein 3e-39 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_002952.2859905.p0 Protein 6e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_009641.5332272.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_013450.8614421.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_007793.3914279.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_007622.3794472.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_002745.1124361.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_009782.5559369.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_002951.3237708.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_003923.1003749.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator NC_002758.1121668.p0 Protein 5e-42 42
Curi_c05260 YP_006787448.1 two-component system signal transduction response regulator AM180355.1.gene1830. Protein 7e-35 41