Gene Information

Name : Eab7_2653 (Eab7_2653)
Accession : YP_006792346.1
Strain : Exiguobacterium antarcticum Eab7
Genome accession: NC_018665
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2617383 - 2618066 bp
Length : 684 bp
Strand : +
Note : -

DNA sequence :
ATGGCACCGACCATCTTAATCGTCGAGGACGATTCGAAAATCGCCCGCCTACTTGAACTGGAGTTAAACCACGCTGGATA
CGCGACGCAGGTCGCCTTCAACGGTAAAGATGGCTTAGTAGCTGCTGAGAACGACATCGATCTCGTCTTACTTGACGTGA
TGATGCCGGAGCTCAGCGGCTTCGAGGTGCTTCGACGGCTTCGCGGAAAAGGTAATCCGGTTCCCGTCATCTTACTGACG
GCACGAGGCGAAGTGTATGACAAGGTCGCAGGGCTTGATCTCGGCGCCAATGATTATGTGACGAAACCGTTTGAAATTGA
AGAATTGTTGGCCCGGATCCGGGCCTTACTCCGCTTGACGACACGTGCCGCCGTCGAAACCAATCAGCTTCATTATGCCG
ATGTCTTGCTGGATTTGGACCGGCATGAAGCGTTTCGCAACGACGTCCCGCTTGATTTGACACCACGCGAATTCGATTTG
TTGTCCTATCTGATGGAAAACAAGGAACACGTCTTGACCCGTGAGCAAATCCTCAATCGGGTTTGGGGGTATGACTACTT
CGGAGAAACGAATATCGTCGACGTCTACATTCGTTATTTACGTAAAAAAATTGATCGCAGTCGATCGCCTCTGATCCAGA
CGGTTCGTGGCATCGGCTATGTCTTAAGGGAGGAAACAGGATGA

Protein sequence :
MAPTILIVEDDSKIARLLELELNHAGYATQVAFNGKDGLVAAENDIDLVLLDVMMPELSGFEVLRRLRGKGNPVPVILLT
ARGEVYDKVAGLDLGANDYVTKPFEIEELLARIRALLRLTTRAAVETNQLHYADVLLDLDRHEAFRNDVPLDLTPREFDL
LSYLMENKEHVLTREQILNRVWGYDYFGETNIVDVYIRYLRKKIDRSRSPLIQTVRGIGYVLREETG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-28 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 8e-41 52
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-34 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-38 49
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-32 46
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-33 44
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family BAC0083 Protein 2e-34 44
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family BAC0308 Protein 5e-31 44
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-27 44
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family BAC0347 Protein 1e-27 43
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-33 43
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 4e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 6e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 6e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 6e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 6e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 6e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 5e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 6e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family BAC0111 Protein 6e-32 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 6e-38 42
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-35 41
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-36 46
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family VFG1386 Protein 7e-42 46
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-33 46
Eab7_2653 YP_006792346.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-28 43