Gene Information

Name : Eab7_2835 (Eab7_2835)
Accession : YP_006792524.1
Strain : Exiguobacterium antarcticum Eab7
Genome accession: NC_018665
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2797106 - 2797816 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
GTGACGGAACGTAAAATCCTCGTCGTCGATGACGAGCAGCCGATTGCCGATATATTAAAATTTAAATTAGAAAAAGAAGG
TTATAGTGTTGCAGTAGCAAATGATGGTGTCGAAGCACTAGAGAAAGTCGAGGAGTTCAAACCCGACCTGATCTTACTCG
ATATCATGTTGCCATTGATGGACGGAATGGAAGTCTGCCGCGAAGTCCGGAAGACATCAAAAGTCCCAATCATCATGTTG
ACGGCAAAGGATTCTGAAATCGATACGGTTTTAGGACTTGAGCTTGGCGCAAACGATTATGTGACGAAGCCATTCAGCTC
ACGTGAACTATTAGCGCGAGTCAAAGCACATCTACGAAATGTCAACGCAGTAGAGGCAACTCCTACGAACGCCGGTCCTG
GTCCGTTAAAAGTGGGAGAACTGTATATCGATACAAATTCTCATACCGTGACACGGAAAGATCAAAAAATCGAACTCACC
CAACGTGAATTCGAGTTGTTGCATTATTTAGCGAAAAACATCGGACAAGTCATGACGCGTGAGCACTTGTTACAGACGGT
CTGGGGTTACGACTACTTTGGAGATGTCCGGACGGTCGATGTGACGGTGCGCCGTCTGCGTGAAAAAGTCGAGGATAACC
CAAGTACACCGATCTATATCATGACCCGCCGTGGTGTCGGCTACTATCTCCAAGACGGGGAGAATGAATAA

Protein sequence :
MTERKILVVDDEQPIADILKFKLEKEGYSVAVANDGVEALEKVEEFKPDLILLDIMLPLMDGMEVCREVRKTSKVPIIML
TAKDSEIDTVLGLELGANDYVTKPFSSRELLARVKAHLRNVNAVEATPTNAGPGPLKVGELYIDTNSHTVTRKDQKIELT
QREFELLHYLAKNIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKVEDNPSTPIYIMTRRGVGYYLQDGENE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-22 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_012469.1.7685629. Protein 3e-54 61
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002952.2859905.p0 Protein 1e-42 54
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002745.1124361.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_009782.5559369.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002951.3237708.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002758.1121668.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_009641.5332272.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_013450.8614421.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_007793.3914279.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_003923.1003749.p0 Protein 1e-42 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_007622.3794472.p0 Protein 8e-43 52
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein HE999704.1.gene2815. Protein 2e-36 49
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_012469.1.7686381. Protein 2e-36 48
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein AE000516.2.gene3505. Protein 5e-34 47
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein HE999704.1.gene1528. Protein 4e-27 46
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein AE016830.1.gene1681. Protein 1e-38 46
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein CP004022.1.gene3215. Protein 2e-28 46
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein CP001138.1.gene4273. Protein 7e-28 46
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein BAC0533 Protein 3e-28 46
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein CP000647.1.gene4257. Protein 3e-28 46
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein CP000034.1.gene3834. Protein 1e-27 45
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002695.1.915041.p Protein 1e-27 45
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein AF155139.2.orf0.gene Protein 2e-28 44
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein FJ349556.1.orf0.gene Protein 2e-29 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_010079.5776364.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002952.2859858.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_007622.3794948.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_003923.1003417.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_013450.8614146.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002951.3238224.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_007793.3914065.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_002758.1121390.p0 Protein 8e-27 43
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein BAC0125 Protein 4e-25 42
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein CP000647.1.gene2531. Protein 2e-24 42
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_014475.1.orf0.gen Protein 4e-30 41
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein NC_005054.2598277.p0 Protein 4e-30 41
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein AF162694.1.orf4.gene Protein 7e-25 41
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein AE015929.1.gene1106. Protein 2e-24 41
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein CP001918.1.gene3444. Protein 4e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein VFG0596 Protein 3e-22 42
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein VFG1390 Protein 3e-32 42
Eab7_2835 YP_006792524.1 two component transcriptional regulator, winged helix family protein VFG1389 Protein 3e-22 41