Gene Information

Name : Eab7_0619 (Eab7_0619)
Accession : YP_006790376.1
Strain : Exiguobacterium antarcticum Eab7
Genome accession: NC_018665
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 639203 - 639889 bp
Length : 687 bp
Strand : -
Note : -

DNA sequence :
ATGCCGGAACAATCCTTTAAAATACTTGTCGTCGATGACGAAGCCCAAATGCGTGACCTGCTCGTCTCAAACCTACAAAA
AGAAAATTACCAGACAACGACAGCCACGAACGGTCAAGAGGCCCTTGATCAAATGCAGCGTGATACATTCCATCTTGTTT
TGCTCGATGTCATGATGCCGGAAATGGACGGCTTGACAGCCTGCATGCGGATTCGAGAATTCTCCAATGTCCCGATCATC
ATGCTGACGGCTCGTTCCGATGAGCTCGATCGTATCCACGGTCTGAAAATCGGAGCTGATGATTACATCACGAAACCATT
CAGTCCACGAGAATTGTTGGCACGCATCGAAGCGACGCTTCGTCGCTCGCACCGGTTTACGGTGGACCAGTCGGCTACCT
TGACGATTGGAAAACTCGAACTCGATACGGAAAGCCGAAGTGTCCATGTCAGTGGGAAACCAATCAGTTTGACACGGAAG
GAATTTGATTTACTCCATTTGTTTGTCCAAAACAACGATAAGGTGTTTTCACGCGAACAACTGCTTGATCAAATTTGGGG
AGCGGATTATATCGGTAACCTTCGGACGGTAGATACCCATATCAAAACATTACGCCTGAAGCTTGGGGAAGCCGGTGGTT
CAATCCAGACGGTTTGGGGCATCGGATATAAATTCGAGGAAGTATGA

Protein sequence :
MPEQSFKILVVDDEAQMRDLLVSNLQKENYQTTTATNGQEALDQMQRDTFHLVLLDVMMPEMDGLTACMRIREFSNVPII
MLTARSDELDRIHGLKIGADDYITKPFSPRELLARIEATLRRSHRFTVDQSATLTIGKLELDTESRSVHVSGKPISLTRK
EFDLLHLFVQNNDKVFSREQLLDQIWGADYIGNLRTVDTHIKTLRLKLGEAGGSIQTVWGIGYKFEEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-38 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 4e-36 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-48 45
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 7e-42 45
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 6e-43 44
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-47 44
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family HE999704.1.gene1202. Protein 1e-36 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-41 43
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-40 42
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 3e-42 42
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family BAC0596 Protein 2e-37 42
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 2e-37 42
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-35 42
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 1e-25 42
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 2e-36 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 4e-36 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 4e-36 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 1e-40 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 8e-41 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 1e-40 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 9e-39 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-41 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-41 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 6e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 4e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family BAC0039 Protein 6e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 4e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 1e-38 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 4e-29 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 7e-29 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 5e-29 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family BAC0533 Protein 4e-29 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 7e-29 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 6e-43 41
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 3e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family VFG1563 Protein 4e-38 42
Eab7_0619 YP_006790376.1 two component transcriptional regulator, winged helix family VFG1702 Protein 6e-38 42