Gene Information

Name : BUPH_00992 (BUPH_00992)
Accession : YP_006793429.1
Strain :
Genome accession: NC_018672
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 926259 - 926924 bp
Length : 666 bp
Strand : -
Note : identified by sequence similarity; putative

DNA sequence :
GTGATCGAAGACGAGCCGAAAACAGGCGCGTACCTGAAAAAAGGCCTGGAAGAATCCGGCTATTCCGTCGACCTCGCCAA
CGATGGTGCTGACGGCCTGCTGCTCGCACAGGAGCAGGACTACGACGTGATCGTCCTCGACGTGATGCTGCCGACAATGG
ACGGTTGGGCCGTGCTGAAAGTACTGCGCGCGACTCATACCACGCCGGTGCTGTTCCTTACCGCGCGCGACGACGTGAAC
GACCGCGTACGTGGTCTCGAACTCGGCGGCGACGATTACCTCGTCAAACCATTTGCGTTTGTCGAACTGCTGGCACGGGT
GCGTACGTTGGCGCGGCGCGGTCCGCCGCGCGAGAGCGAACTTCTCGCGATCGGCGACCTGGAGATGGACATCAACCGGC
GGCGCGTGAAACGCGGCGCAACGCGTATCGACCTCACGCCCCGCGAGTTCTCGCTGTTGCAACTGCTTTTGCGTCGTCAG
GGCGAGGTGCTGAGCCGCACGCAGATCGCTTCATACGTGTGGGACATGAACTTCGACAGCGATACGAACGTGGTCGAGGT
GGCGATTCGCCGCTTGCGCGCGAAGATCGACGACGCTTTCCCCGTCAAGCTGATCCAGACCGTGCGCGGCGTCGGATATG
TAATCGAAGCCAAAGAGCCGGACTGA

Protein sequence :
MIEDEPKTGAYLKKGLEESGYSVDLANDGADGLLLAQEQDYDVIVLDVMLPTMDGWAVLKVLRATHTTPVLFLTARDDVN
DRVRGLELGGDDYLVKPFAFVELLARVRTLARRGPPRESELLAIGDLEMDINRRRVKRGATRIDLTPREFSLLQLLLRRQ
GEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIQTVRGVGYVIEAKEPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-51 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-51 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0125 Protein 8e-65 67
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0197 Protein 3e-65 63
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0083 Protein 6e-64 63
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0638 Protein 4e-53 61
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0308 Protein 3e-59 59
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0111 Protein 8e-58 57
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0347 Protein 4e-53 53
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007793.3914065.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002758.1121390.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_010079.5776364.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002952.2859858.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007622.3794948.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_003923.1003417.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_013450.8614146.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002951.3238224.p0 Protein 4e-34 42
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002952.2859905.p0 Protein 4e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002758.1121668.p0 Protein 7e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_009641.5332272.p0 Protein 7e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_013450.8614421.p0 Protein 7e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007793.3914279.p0 Protein 7e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_003923.1003749.p0 Protein 8e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007622.3794472.p0 Protein 4e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002745.1124361.p0 Protein 7e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_009782.5559369.p0 Protein 7e-30 41
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002951.3237708.p0 Protein 7e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG0596 Protein 4e-52 56
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1389 Protein 4e-35 48
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1390 Protein 4e-34 43
BUPH_00992 YP_006793429.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1386 Protein 5e-32 41