Gene Information

Name : C270_02385 (C270_02385)
Accession : YP_006795389.1
Strain : Leuconostoc carnosum JB16
Genome accession: NC_018673
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 496358 - 497050 bp
Length : 693 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACAAGTATTTTAGTGGTGGATGATGAATTAGCGATTGCAACGTTGTTAAAGTATAATCTAGAGCAAAATGGATTTGA
CGTCACTTTAGCCGAAACAGGTGATCAAGCCTACGAACTTGCTTCTAAACAGGCATTTGATGCTATTCTATTAGATTTGA
TGCTACCAGTGATGGATGGCATGACAGTATTAAAAAATTTACGGCAAGATAAAATTAGCACACCAGTAATTCTGATTACA
GCTAAGGGTGATGAATTTGATCGTATTTTTGGTTTAGAATTAGGTGCAGATGATTATATTACCAAACCTTTTAGTCCACG
TGAAGTTATTGCCCGACTAAAAGCCGTGTTACGCCGTTCGCAGCAAACAAAACAGCAGAATGCGACACAGCTTGATGTGA
TTGAGATTCAAAATTTAACGATTGATGATAGTAAAAAAGTAGTGACTAAAGATGGTGTGATCTTAACTTTGACACCTCGA
GAATATGAGTTATTATTGTATTTTGCCCAACGGCTAGGACGTGTGATTGATCGTGAGACAATTTTGACAGCAGTATGGGG
TTATGAATTCACTGGTGAAAGCCGCATGGTTGACATGCATATCAGTAATTTACGGGAAAAGATTGAGCGTAATCCAAAGA
CACCAAAGTTACTCAAAACTGTACGTGGCTTTGGCTATACGATGGTTGTGTAG

Protein sequence :
MTSILVVDDELAIATLLKYNLEQNGFDVTLAETGDQAYELASKQAFDAILLDLMLPVMDGMTVLKNLRQDKISTPVILIT
AKGDEFDRIFGLELGADDYITKPFSPREVIARLKAVLRRSQQTKQQNATQLDVIEIQNLTIDDSKKVVTKDGVILTLTPR
EYELLLYFAQRLGRVIDRETILTAVWGYEFTGESRMVDMHISNLREKIERNPKTPKLLKTVRGFGYTMVV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-42 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C270_02385 YP_006795389.1 response regulator NC_002952.2859905.p0 Protein 1e-56 56
C270_02385 YP_006795389.1 response regulator NC_002745.1124361.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator NC_009782.5559369.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator NC_002951.3237708.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator NC_003923.1003749.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator NC_002758.1121668.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator NC_007622.3794472.p0 Protein 1e-56 56
C270_02385 YP_006795389.1 response regulator NC_009641.5332272.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator NC_013450.8614421.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator NC_007793.3914279.p0 Protein 2e-56 56
C270_02385 YP_006795389.1 response regulator AE016830.1.gene1681. Protein 3e-56 52
C270_02385 YP_006795389.1 response regulator HE999704.1.gene2815. Protein 2e-56 50
C270_02385 YP_006795389.1 response regulator NC_012469.1.7686381. Protein 4e-53 47
C270_02385 YP_006795389.1 response regulator NC_012469.1.7685629. Protein 9e-44 46
C270_02385 YP_006795389.1 response regulator CP000034.1.gene3834. Protein 3e-36 45
C270_02385 YP_006795389.1 response regulator CP001138.1.gene4273. Protein 1e-36 45
C270_02385 YP_006795389.1 response regulator CP000647.1.gene4257. Protein 9e-37 45
C270_02385 YP_006795389.1 response regulator NC_002695.1.915041.p Protein 3e-36 45
C270_02385 YP_006795389.1 response regulator BAC0533 Protein 9e-37 45
C270_02385 YP_006795389.1 response regulator CP001918.1.gene5135. Protein 4e-32 45
C270_02385 YP_006795389.1 response regulator CP004022.1.gene3215. Protein 8e-40 44
C270_02385 YP_006795389.1 response regulator CP000675.2.gene1535. Protein 3e-41 44
C270_02385 YP_006795389.1 response regulator CP001485.1.gene721.p Protein 2e-38 42
C270_02385 YP_006795389.1 response regulator HE999704.1.gene1528. Protein 1e-36 41
C270_02385 YP_006795389.1 response regulator BAC0197 Protein 3e-35 41
C270_02385 YP_006795389.1 response regulator AF162694.1.orf4.gene Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
C270_02385 YP_006795389.1 response regulator VFG1386 Protein 1e-38 42
C270_02385 YP_006795389.1 response regulator VFG1563 Protein 4e-42 41
C270_02385 YP_006795389.1 response regulator VFG1702 Protein 7e-42 41