Gene Information

Name : AMBAS45_11390 (AMBAS45_11390)
Accession : YP_006803224.1
Strain : Alteromonas macleodii Balearic Sea AD45
Genome accession: NC_018679
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2654464 - 2654739 bp
Length : 276 bp
Strand : +
Note : COG2608 Copper chaperone

DNA sequence :
ATGAAGAAGTTATTGATTACAACTTTATTGTTGATAAGCAGCACGGCGACGTTTGCAAAAGATGTAACTGTTACGTTAGA
AGTTCCGTCTATGGATTGTGTAACGTGCCCGATAACAGTAGAAAAAGCACTTGAGCGCGTTAAAGGCGTTAAACAAGTGG
AAGTGACATTTGAAAATAAACTTGCTGTTGTAACATTTGACGATGAGATAACAAATCCTGATGCACTAACAAAGGCTACA
AAGAATGCTGGTTATCCTTCATTAGTGAAGTCGTAA

Protein sequence :
MKKLLITTLLLISSTATFAKDVTVTLEVPSMDCVTCPITVEKALERVKGVKQVEVTFENKLAVVTFDDEITNPDALTKAT
KNAGYPSLVKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 4e-16 67
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-15 62
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-15 62
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-15 62
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-15 62
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-15 62
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-15 62
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 4e-15 59
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 6e-15 59
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-16 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AMBAS45_11390 YP_006803224.1 mercuric transport periplasmic protein BAC0231 Protein 2e-15 64
AMBAS45_11390 YP_006803224.1 mercuric transport periplasmic protein BAC0678 Protein 7e-16 64
AMBAS45_11390 YP_006803224.1 mercuric transport periplasmic protein BAC0679 Protein 9e-16 64
AMBAS45_11390 YP_006803224.1 mercuric transport periplasmic protein BAC0675 Protein 4e-16 64
AMBAS45_11390 YP_006803224.1 mercuric transport periplasmic protein BAC0674 Protein 3e-14 54