Gene Information

Name : O3I_005825 (O3I_005825)
Accession : YP_006806102.1
Strain : Nocardia brasiliensis HUJEG-1
Genome accession: NC_018681
Putative virulence/resistance : Resistance
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1348899 - 1349576 bp
Length : 678 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACGGCCGTACTGCTAGCTGAAGACGACGAGGCGATCGCCGCGCCGTTGTCGCGCGCCTTGGGGCGCGAGGGGTACTC
GGTGACCGTCGAGCGCTTCGGTCCGGCCGTGCTCGAACGAGCCCTGGAAGGGCATCACGATCTGCTGATCCTCGACCTCG
GCCTGCCCGGCATGGACGGGCTGGAGGTGTGCCGTCAGGTCCGGGCCAGCGGCGCGGACATCGCCGTGCTGATGCTCACC
GCCCGCACCGACGAGGTCGATTTCGTGGTCGGCCTCGACGCGGGCGCCGACGACTACGTCGGCAAGCCGTTCCGGCTCGC
CGAACTGCTGGCGCGGGTGCGAGCCCTGTTGCGGCGCAGCGGGATCGGCGACGACACGGTGGAGGTCGGCGGCATCCGGC
TGGAACCGGCCGCGCGCCGGGTGCTGGTGAACGGCGCCGAGATCGGCTTGGCCAACAAGGAATACGAGTTGCTGAAGGTG
CTGATCGACCGGGCCGGTCAGGTGGTGCCGCGCGAGACCATCCTGCGCGAGGTCTGGGGCGACGCCGAGTTGCGCGGCTC
CAAGACGCTGGACATGCACATGTCCTGGCTGCGTCGCAAGATCGGCGACGAGGGCCCGATGGCCGAGCGGCGCATCGTCA
CCGTCCGCGGTGTCGGCTTCCGGCTGAACACCGACTGA

Protein sequence :
MTAVLLAEDDEAIAAPLSRALGREGYSVTVERFGPAVLERALEGHHDLLILDLGLPGMDGLEVCRQVRASGADIAVLMLT
ARTDEVDFVVGLDAGADDYVGKPFRLAELLARVRALLRRSGIGDDTVEVGGIRLEPAARRVLVNGAEIGLANKEYELLKV
LIDRAGQVVPRETILREVWGDAELRGSKTLDMHMSWLRRKIGDEGPMAERRIVTVRGVGFRLNTD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-15 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_005825 YP_006806102.1 two-component system response regulator NC_002951.3238224.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator NC_007793.3914065.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator NC_002758.1121390.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator NC_010079.5776364.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator NC_002952.2859858.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator NC_007622.3794948.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator NC_003923.1003417.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator NC_013450.8614146.p0 Protein 1e-23 43
O3I_005825 YP_006806102.1 two-component system response regulator AE015929.1.gene1106. Protein 5e-21 42
O3I_005825 YP_006806102.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-25 41
O3I_005825 YP_006806102.1 two-component system response regulator AE016830.1.gene2255. Protein 1e-15 41
O3I_005825 YP_006806102.1 two-component system response regulator U35369.1.gene1.p01 Protein 1e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_005825 YP_006806102.1 two-component system response regulator VFG1390 Protein 1e-23 43