Gene Information

Name : O3I_035100 (O3I_035100)
Accession : YP_006811941.1
Strain : Nocardia brasiliensis HUJEG-1
Genome accession: NC_018681
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 7916841 - 7917518 bp
Length : 678 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAGCCGAAGATTCTGGTCGTCGACGACGATATGGCGCTCGCTGAGATGCTCACGATCGTCTTGCGCGGGGAAGGGTT
CGACCCGCATGTGGTCGGCGACGGCACACAGGCCCTCGCGGCGGTTCGGGAGATCCGCCCCGATCTGGTGCTGCTGGACC
TGATGCTGCCCGGCATGAACGGCATCGACGTGTGCCGGGTGCTGCGCGCGGATTCGGGCGTGCCCATCGTGATGCTGACG
GCGAAGACGGACACCGTCGACGTCGTGCTCGGTTTGGAGTCGGGCGCCGACGATTACATCGTCAAGCCGTTCAAGCCCAA
GGAATTGGTCGCCCGGGTGCGCGCCAGGCTGCGCCGCACCGAGGACGAACCCGCGGAGATGCTCTCGATCGCCGATATCG
TCATCGACGTGCCCGCGCACAAGGTGACCCGCGGCGGACAGCAGATCTCGCTGACGCCCTTGGAGTTCGATCTGCTGGTG
GCGCTGGCCCGCAAGCCGCGTCAGGTGTTCACCCGTGAGGTGCTGCTCGAGCAGGTGTGGGGGTACCGGCACGCCGCCGA
TACCCGACTGGTCAACGTGCACGTCCAGCGGTTGCGCGCCAAGGTCGAGAAGGATCCCGAGAATCCGGAGATCGTCTTGA
CCGTTCGTGGTGTCGGCTACAAAGCTGGACCACCGTGA

Protein sequence :
MKPKILVVDDDMALAEMLTIVLRGEGFDPHVVGDGTQALAAVREIRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLT
AKTDTVDVVLGLESGADDYIVKPFKPKELVARVRARLRRTEDEPAEMLSIADIVIDVPAHKVTRGGQQISLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKVEKDPENPEIVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_035100 YP_006811941.1 two-component system response regulator AE000516.2.gene3505. Protein 3e-91 91
O3I_035100 YP_006811941.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-42 46
O3I_035100 YP_006811941.1 two-component system response regulator NC_012469.1.7686381. Protein 2e-39 45
O3I_035100 YP_006811941.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-32 44
O3I_035100 YP_006811941.1 two-component system response regulator NC_012469.1.7685629. Protein 3e-38 44
O3I_035100 YP_006811941.1 two-component system response regulator BAC0125 Protein 1e-31 43
O3I_035100 YP_006811941.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-37 43
O3I_035100 YP_006811941.1 two-component system response regulator BAC0347 Protein 4e-24 42
O3I_035100 YP_006811941.1 two-component system response regulator BAC0111 Protein 2e-28 42
O3I_035100 YP_006811941.1 two-component system response regulator BAC0197 Protein 2e-27 42
O3I_035100 YP_006811941.1 two-component system response regulator CP001918.1.gene3444. Protein 3e-37 42
O3I_035100 YP_006811941.1 two-component system response regulator NC_003923.1003417.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_013450.8614146.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_002951.3238224.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_007793.3914065.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_002758.1121390.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_010079.5776364.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_002952.2859858.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_007622.3794948.p0 Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator CP000675.2.gene1535. Protein 2e-30 41
O3I_035100 YP_006811941.1 two-component system response regulator HE999704.1.gene1528. Protein 6e-35 41
O3I_035100 YP_006811941.1 two-component system response regulator FJ349556.1.orf0.gene Protein 2e-32 41
O3I_035100 YP_006811941.1 two-component system response regulator CP001485.1.gene721.p Protein 1e-26 41
O3I_035100 YP_006811941.1 two-component system response regulator BAC0083 Protein 7e-27 41
O3I_035100 YP_006811941.1 two-component system response regulator CP000034.1.gene3671. Protein 3e-32 41
O3I_035100 YP_006811941.1 two-component system response regulator CP001138.1.gene2239. Protein 1e-36 41
O3I_035100 YP_006811941.1 two-component system response regulator BAC0039 Protein 3e-37 41
O3I_035100 YP_006811941.1 two-component system response regulator BAC0596 Protein 1e-36 41
O3I_035100 YP_006811941.1 two-component system response regulator CP000034.1.gene2186. Protein 3e-37 41
O3I_035100 YP_006811941.1 two-component system response regulator NC_002695.1.916589.p Protein 2e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_035100 YP_006811941.1 two-component system response regulator VFG1390 Protein 2e-33 44
O3I_035100 YP_006811941.1 two-component system response regulator VFG1389 Protein 2e-28 43
O3I_035100 YP_006811941.1 two-component system response regulator VFG1702 Protein 9e-35 42
O3I_035100 YP_006811941.1 two-component system response regulator VFG1563 Protein 6e-35 41