Gene Information

Name : O3I_041360 (O3I_041360)
Accession : YP_006813191.1
Strain : Nocardia brasiliensis HUJEG-1
Genome accession: NC_018681
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 9253528 - 9254103 bp
Length : 576 bp
Strand : +
Note : COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGGTGTCAGTTTGTCCAAGGGCGGCAATGTCTCGCTGACCAAGGCGGCGCCTAACCTCACCGCCGTCGCAGTCGGCCT
AGGGTGGGATGTGCGGACCACCACCGGTACCGACTTCGACCTGGACGCGAGCGCGATCGCGACCGGCGCGGACAAGAAGG
TGCTCTCCGACCAGCACTTCGTGTTCTTCAACAACCTGAAGTCCCCCGAGGGCGCGATCGAGCACGCCGGTGACAACACC
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAACGTCGACCTGGCGAACACCCCGCCGACCATCGAAAGCATCTTCTT
CCCGGTCTCGATCTACGACGCCGAGACCCGGCAGCAGTCGTTCGGTCAGGTCCGCAACGCGTACATCCGCGTCGTCGACC
GCAGCAACAACAACGAACTCGCCCGCTACGACCTCACCGAGGACGCCTCGACCGAGACCGCCATGGTGTTCGGCGAGCTG
TACCGTAACGGGGCGGAGTGGAAGTTCCGCGCCATCGGCCAGGGCTACGCCTCCGGCCTCGCGGGCATCGCCCGTGATTA
CGGCGTGAACGTCTAG

Protein sequence :
MGVSLSKGGNVSLTKAAPNLTAVAVGLGWDVRTTTGTDFDLDASAIATGADKKVLSDQHFVFFNNLKSPEGAIEHAGDNT
TGEGEGDDEVINVDLANTPPTIESIFFPVSIYDAETRQQSFGQVRNAYIRVVDRSNNNELARYDLTEDASTETAMVFGEL
YRNGAEWKFRAIGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-51 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-51 61
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-51 61
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-48 60
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-51 60
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-50 60
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-25 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-19 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-19 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
O3I_041360 YP_006813191.1 hypothetical protein BAC0389 Protein 2e-50 60
O3I_041360 YP_006813191.1 hypothetical protein BAC0390 Protein 4e-51 59
O3I_041360 YP_006813191.1 hypothetical protein BAC0392 Protein 2e-19 41