Gene Information

Name : MC28_3867 (MC28_3867)
Accession : YP_006830688.1
Strain : Bacillus thuringiensis MC28
Genome accession: NC_018693
Putative virulence/resistance : Resistance
Product : export protein for polysaccharides and teichoic acids
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3756430 - 3757149 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence :
ATGAACAATCGTATTTTAGTAGTTGATGATGAGGAATTTATCTTAACTTTAATTGAATTTAATTTACAACAAGCTGGTTT
TGAAGTTATAACAGCGATGGACGGAGAAATGGCGCTTCAAAAAGCGACAACAGAACGTCCGGATTTAATTATATTAGATT
TAATGCTTCCAAAAATGGATGGTATGGAAGTTTGTAAAGAATTACGATTGCAGCGTGTTATGACACCGATTTTAATGTTA
ACAGCAAAAGATGATGAATTTGATAAGGTGCTAGGTCTTGAACTTGGGGCGGATGATTATATGACGAAGCCATTTAGTCC
AAGGGAAGTTGTTGCTCGTGTGAAGGCGATTTTACGTCGTACGAAATTACAGCAAGAAGAGCAAGTTGCAGAAGCGCCAG
ATGAAGATAGCATCCTAATTGCAGACCTTAAAATTTTACCGGAGTTTTATGAGGCTTATTTCCAAGGAAGAAAGCTTGAA
TTAACCCCAAAAGAATTTGAACTACTTGTTTATCTTGCGAAAAATAAAAGTCGCGTGTTGACGCGTGATCAATTATTAAG
TGCTGTATGGAATTATGATTTTGCTGGTGATACACGAATTGTTGATGTTCATATTAGCCACTTGCGCGATAAAATTGAAA
AAAATACGAAAAAACCGACGTACATTAAAACGATACGTGGTTTAGGATATAAATTAGAGGAGCCAAAAGGGGATGAATAA

Protein sequence :
MNNRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTERPDLIILDLMLPKMDGMEVCKELRLQRVMTPILML
TAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILRRTKLQQEEQVAEAPDEDSILIADLKILPEFYEAYFQGRKLE
LTPKEFELLVYLAKNKSRVLTRDQLLSAVWNYDFAGDTRIVDVHISHLRDKIEKNTKKPTYIKTIRGLGYKLEEPKGDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-33 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 9e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids HE999704.1.gene2815. Protein 2e-73 66
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_009782.5559369.p0 Protein 5e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002951.3237708.p0 Protein 5e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002952.2859905.p0 Protein 8e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_003923.1003749.p0 Protein 4e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002758.1121668.p0 Protein 5e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_009641.5332272.p0 Protein 5e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_013450.8614421.p0 Protein 5e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_007793.3914279.p0 Protein 5e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_007622.3794472.p0 Protein 6e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002745.1124361.p0 Protein 5e-74 64
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_012469.1.7686381. Protein 8e-63 57
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids AE016830.1.gene1681. Protein 2e-63 54
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_012469.1.7685629. Protein 1e-53 53
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids BAC0197 Protein 1e-28 44
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids AE000516.2.gene3505. Protein 1e-40 44
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP001485.1.gene721.p Protein 3e-35 44
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP001918.1.gene5135. Protein 1e-30 44
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids FJ349556.1.orf0.gene Protein 1e-39 43
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP004022.1.gene3215. Protein 2e-35 43
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids BAC0533 Protein 2e-33 43
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP000647.1.gene4257. Protein 2e-33 43
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002951.3238224.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_007793.3914065.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002758.1121390.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_010079.5776364.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002952.2859858.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_007622.3794948.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_003923.1003417.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_013450.8614146.p0 Protein 3e-38 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids AF155139.2.orf0.gene Protein 2e-37 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP000034.1.gene3834. Protein 2e-32 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP001138.1.gene4273. Protein 8e-33 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002695.1.915041.p Protein 2e-32 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_002695.1.916589.p Protein 1e-36 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids BAC0039 Protein 9e-37 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids BAC0596 Protein 4e-36 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP000034.1.gene2186. Protein 9e-37 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP001138.1.gene2239. Protein 4e-36 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP001918.1.gene3444. Protein 3e-36 42
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids AF310956.2.orf0.gene Protein 6e-34 41
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids AE016830.1.gene2255. Protein 4e-33 41
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids U35369.1.gene1.p01 Protein 4e-33 41
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids AE015929.1.gene1106. Protein 3e-36 41
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_014475.1.orf0.gen Protein 1e-39 41
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids NC_005054.2598277.p0 Protein 1e-39 41
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids CP004022.1.gene1676. Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids VFG1386 Protein 2e-40 44
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids VFG1389 Protein 1e-34 44
MC28_3867 YP_006830688.1 export protein for polysaccharides and teichoic acids VFG1390 Protein 2e-36 41