Gene Information

Name : BUPH_06385 (BUPH_06385)
Accession : YP_006832349.1
Strain :
Genome accession: NC_018695
Putative virulence/resistance : Unknown
Product : transposase
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 18619 - 18966 bp
Length : 348 bp
Strand : +
Note : identified by sequence similarity; putative

DNA sequence :
GTGATCGGTCTTCCTGCCGGCACGCGTGTGTGGCTTGCTGCGGGCGTGACGGACATGCGGGCCGGATTCAACAGTCTCGC
CGCCAAGGTGCAGACCGTGCTTGAACGGGATCCGTTCTGCGGGCACGTCTTCGTGTTCCGCGGCAAACGCGGCGACCTGC
TCAAAGTGCTGTGGTGGAGCGGCGATGGCATGTGCCTGCTGATGAAGCGGCTCGAGAAGGGGCGCTTCGTATGGCCTCAA
GCCGACGGTGGTGTTATTTGCCTGAGCCCGGCACAACTATCGATGCTGCTCGAAGGCATCGACTGGCGGCACCCGACGAG
AACGGCACGACCGACCTCGGCGTTGTAA

Protein sequence :
MIGLPAGTRVWLAAGVTDMRAGFNSLAAKVQTVLERDPFCGHVFVFRGKRGDLLKVLWWSGDGMCLLMKRLEKGRFVWPQ
ADGGVICLSPAQLSMLLEGIDWRHPTRTARPTSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-38 76
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-36 67
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-36 67
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-36 67
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-34 67
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-34 67
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-33 66
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-33 66
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-33 66
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-33 66
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-33 66
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-33 66
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-33 66
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-32 66
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-33 66
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-32 66
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-33 64
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-33 64
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-33 64
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-24 63
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-31 55
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 1e-31 55
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 1e-31 55
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 9e-30 54
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 9e-30 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BUPH_06385 YP_006832349.1 transposase VFG1665 Protein 7e-37 67
BUPH_06385 YP_006832349.1 transposase VFG1698 Protein 3e-34 67
BUPH_06385 YP_006832349.1 transposase VFG0792 Protein 1e-33 66
BUPH_06385 YP_006832349.1 transposase VFG1709 Protein 1e-33 66
BUPH_06385 YP_006832349.1 transposase VFG1052 Protein 2e-33 64
BUPH_06385 YP_006832349.1 transposase VFG1517 Protein 5e-25 63
BUPH_06385 YP_006832349.1 transposase VFG1737 Protein 4e-32 55