Gene Information

Name : AXY_16900 (AXY_16900)
Accession : YP_006845584.1
Strain : Amphibacillus xylanus NBRC 15112
Genome accession: NC_018704
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1727309 - 1727974 bp
Length : 666 bp
Strand : -
Note : -

DNA sequence :
ATGAATATTCTCATTGTTGAAGATGAAAAGAATTTAGCTCGTGCTTTACAATTGGAATTAGAATATGAAGGTTATCAGGT
GACAACAACACATGATGGACGAGAAGCTTGGGGCATCATTAGTGATAAGACATATGACTTAATATTACTAGATATTATGC
TACCTGGGTTAAGTGGAATGGAAATTCTCCGGCGGATGAGAAAAGACGGCTCACTAACACCGGTTATCCTATTAACAGCA
AGAGACACTACTTATGATAAAGTTAGCGGACTAGATTTAGGTGCAAATGATTATATTACTAAACCATTTGAAATCGAGGA
ATTGTTAGCAAGAATTAGAGCTCAATTACGACAAAGTCAAAATCAAGTAAGCAAAAGTAAGCAGATCAAAATTAAAGATC
TCGTTATTGATATTGGCCAATACCAAACAACATGGCAAGATGAAGTGGTTGAATTAACTAAGCGAGAGTTTGATTTACTC
GTATATTTAGCAAGTAACGCAAACCAAGTCTTATCACGAGATCAGTTGCTTAGTGAGGTTTGGGGTTTTGATTATGTAGG
AGAAACAAATGTTGTTGATGTATATATTCGTTATTTAAGACAAAAAATTGACTATCAATTAATCGAGACAGTTAGAGGAA
TCGGTTATGTTATAAGGACTGAATGA

Protein sequence :
MNILIVEDEKNLARALQLELEYEGYQVTTTHDGREAWGIISDKTYDLILLDIMLPGLSGMEILRRMRKDGSLTPVILLTA
RDTTYDKVSGLDLGANDYITKPFEIEELLARIRAQLRQSQNQVSKSKQIKIKDLVIDIGQYQTTWQDEVVELTKREFDLL
VYLASNANQVLSRDQLLSEVWGFDYVGETNVVDVYIRYLRQKIDYQLIETVRGIGYVIRTE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-36 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AXY_16900 YP_006845584.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-49 54
AXY_16900 YP_006845584.1 two-component system response regulator AE015929.1.gene1106. Protein 5e-43 51
AXY_16900 YP_006845584.1 two-component system response regulator HE999704.1.gene1528. Protein 1e-43 51
AXY_16900 YP_006845584.1 two-component system response regulator BAC0197 Protein 7e-36 45
AXY_16900 YP_006845584.1 two-component system response regulator BAC0125 Protein 2e-35 44
AXY_16900 YP_006845584.1 two-component system response regulator BAC0308 Protein 2e-36 44
AXY_16900 YP_006845584.1 two-component system response regulator NC_012469.1.7685629. Protein 2e-41 43
AXY_16900 YP_006845584.1 two-component system response regulator BAC0083 Protein 9e-37 42
AXY_16900 YP_006845584.1 two-component system response regulator FJ349556.1.orf0.gene Protein 4e-33 42
AXY_16900 YP_006845584.1 two-component system response regulator HE999704.1.gene2815. Protein 5e-42 42
AXY_16900 YP_006845584.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AXY_16900 YP_006845584.1 two-component system response regulator VFG0596 Protein 3e-36 44
AXY_16900 YP_006845584.1 two-component system response regulator VFG1389 Protein 5e-38 43
AXY_16900 YP_006845584.1 two-component system response regulator VFG1390 Protein 9e-45 42