Gene Information

Name : AXY_23800 (AXY_23800)
Accession : YP_006846274.1
Strain : Amphibacillus xylanus NBRC 15112
Genome accession: NC_018704
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2533718 - 2534419 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGAATCATAAAATTTTAGTGGTAGACGATGAAAAGCCAATAGCAGATATATTAAAATTCAACTTAGAAAATGAAGGTTA
TGAGGTCATATGTGCGTATGATGGTGATGAAGCGATTGAATTAACACATAAAGAAAACCCAGATTTATTATTACTTGATA
TCATGTTACCAAAACGTGATGGTAATGAAGTTTGTCGGGAAATAAGAAAGACACACAATATGCCAATAATTATGCTAACA
GCTAAAGACTCGGAAATTGATAAAGTTTTAGGTCTAGAGCTTGGTGCTGATGACTATGTGACAAAACCATTTAGTAATCG
TGAAGTAATTGCCAGAGTTAAAGCTAACTTAAGACGTCAGCAACAACCATATGATCAGACAAGTGTAACAAAAGATATTC
AAGTAGGGACATTAATTATTCATCCAGATGCTTATGCGGTGACTAAGGGAGGCAAGCAGGTGGATTTGACTCATCGTGAG
TTTGAATTGCTTCATTACTTAGCGAGACATATTGGGCAAGTCATGACACGTGAGCACCTATTAGAAACTGTTTGGGGCTA
TGACTATTATGGTGATGTGAGAACAGTTGATGTGACGGTCAGAAGACTTCGCGAAAAAATAGAGGATAACCCAAGTAATC
CAGTTTGGATCATTACCCGCCGAGGTGTAGGTTACTATTTACGAAATCCTGAACAGGAGTAA

Protein sequence :
MNHKILVVDDEKPIADILKFNLENEGYEVICAYDGDEAIELTHKENPDLLLLDIMLPKRDGNEVCREIRKTHNMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSNREVIARVKANLRRQQQPYDQTSVTKDIQVGTLIIHPDAYAVTKGGKQVDLTHRE
FELLHYLARHIGQVMTREHLLETVWGYDYYGDVRTVDVTVRRLREKIEDNPSNPVWIITRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-34 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AXY_23800 YP_006846274.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-59 68
AXY_23800 YP_006846274.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-55 56
AXY_23800 YP_006846274.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_002952.2859905.p0 Protein 5e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-55 55
AXY_23800 YP_006846274.1 two-component system response regulator HE999704.1.gene2815. Protein 7e-45 53
AXY_23800 YP_006846274.1 two-component system response regulator NC_012469.1.7686381. Protein 9e-41 50
AXY_23800 YP_006846274.1 two-component system response regulator AM180355.1.gene1830. Protein 1e-39 48
AXY_23800 YP_006846274.1 two-component system response regulator AF155139.2.orf0.gene Protein 9e-37 48
AXY_23800 YP_006846274.1 two-component system response regulator AF162694.1.orf4.gene Protein 7e-39 47
AXY_23800 YP_006846274.1 two-component system response regulator AE000516.2.gene3505. Protein 6e-35 46
AXY_23800 YP_006846274.1 two-component system response regulator NC_005054.2598277.p0 Protein 2e-34 45
AXY_23800 YP_006846274.1 two-component system response regulator NC_014475.1.orf0.gen Protein 2e-34 45
AXY_23800 YP_006846274.1 two-component system response regulator FJ349556.1.orf0.gene Protein 1e-35 45
AXY_23800 YP_006846274.1 two-component system response regulator HE999704.1.gene1528. Protein 2e-31 44
AXY_23800 YP_006846274.1 two-component system response regulator CP001138.1.gene4273. Protein 3e-35 44
AXY_23800 YP_006846274.1 two-component system response regulator DQ212986.1.gene4.p01 Protein 1e-36 44
AXY_23800 YP_006846274.1 two-component system response regulator AE016830.1.gene1681. Protein 3e-41 43
AXY_23800 YP_006846274.1 two-component system response regulator BAC0533 Protein 3e-35 43
AXY_23800 YP_006846274.1 two-component system response regulator CP000647.1.gene4257. Protein 3e-35 43
AXY_23800 YP_006846274.1 two-component system response regulator AF130997.1.orf0.gene Protein 5e-34 43
AXY_23800 YP_006846274.1 two-component system response regulator NC_002695.1.915041.p Protein 4e-36 43
AXY_23800 YP_006846274.1 two-component system response regulator CP004022.1.gene3215. Protein 2e-38 43
AXY_23800 YP_006846274.1 two-component system response regulator CP000034.1.gene3834. Protein 4e-36 43
AXY_23800 YP_006846274.1 two-component system response regulator NC_013450.8614146.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator NC_002951.3238224.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator NC_007793.3914065.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator NC_002758.1121390.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator NC_010079.5776364.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator NC_002952.2859858.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator NC_007622.3794948.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator NC_003923.1003417.p0 Protein 3e-35 42
AXY_23800 YP_006846274.1 two-component system response regulator EU250284.1.orf4.gene Protein 6e-38 42
AXY_23800 YP_006846274.1 two-component system response regulator CP001918.1.gene5135. Protein 1e-30 42
AXY_23800 YP_006846274.1 two-component system response regulator AE015929.1.gene1106. Protein 7e-29 41
AXY_23800 YP_006846274.1 two-component system response regulator NC_011586.7046392.p0 Protein 5e-24 41
AXY_23800 YP_006846274.1 two-component system response regulator NC_010410.6002907.p0 Protein 5e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AXY_23800 YP_006846274.1 two-component system response regulator VFG1563 Protein 3e-34 45
AXY_23800 YP_006846274.1 two-component system response regulator VFG1702 Protein 4e-34 45
AXY_23800 YP_006846274.1 two-component system response regulator VFG1389 Protein 7e-25 44
AXY_23800 YP_006846274.1 two-component system response regulator VFG1390 Protein 5e-35 41