Gene Information

Name : Emtol_3658 (Emtol_3658)
Accession : YP_006874811.1
Strain : Emticicia oligotrophica DSM 17448
Genome accession: NC_018748
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4014799 - 4015482 bp
Length : 684 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: sli:Slin_2929

DNA sequence :
ATGGCAGCAACTAAAATATTACTTGTAGAAGATGAATTAAGGCTAGCAGAATATGTAAAGAAGGGCTTAGAAGAAAATGG
TTTTAGTGTTGATGTAGCCTATGATGGACAGATAGGGAGAAGTTTAGCATTGAGCAATGCCTATGACCTAATGGTTTTTG
ATGTTAATCTTCCTAAAATAAGCGGTCTTGAGTTAACAAAAAAGCTTCGTTCAGAGCAGATTAAAACCCCAATAATGATT
CTTACAGCAATGGGAACTACTCAGGATAAAATTTCTGGATTCGACTCGGGTGCTGATGACTATTTAGTTAAGCCATTTGA
CTTTTTAGAATTAATTGCTCGCCTTAATGCATTATATCGCCGCTCAAGTGAGGTTGCGGAAATGAAAAAAAATCTACAAG
TTGCAGATTTGGAGTTAGACCTTAATGAAAAAAATGCTAGAAGAGGGGGTAAATTGATTACCCTTACTTCAAAAGAATAT
ATGCTTCTTGAGTTTTTTATGAGAAATAATGGAAAAGTTGTTTCTCGTACTGAAATTGCTGAAAAAGTTTGGAATCTCAA
TTTTGATACTGGAACGAATACGATTGATGTTTATGTAAATTTTCTACGAAAAAAAATAGATCAGAATTATGAAGTTAAGC
TTATTCATACGGTTGTGGGTAGAGGTTATATGATGAAAGGATGA

Protein sequence :
MAATKILLVEDELRLAEYVKKGLEENGFSVDVAYDGQIGRSLALSNAYDLMVFDVNLPKISGLELTKKLRSEQIKTPIMI
LTAMGTTQDKISGFDSGADDYLVKPFDFLELIARLNALYRRSSEVAEMKKNLQVADLELDLNEKNARRGGKLITLTSKEY
MLLEFFMRNNGKVVSRTEIAEKVWNLNFDTGTNTIDVYVNFLRKKIDQNYEVKLIHTVVGRGYMMKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-43 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-42 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family BAC0111 Protein 6e-52 51
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family BAC0347 Protein 3e-46 48
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-44 46
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family BAC0083 Protein 7e-48 46
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family BAC0197 Protein 6e-44 45
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family BAC0308 Protein 9e-42 44
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family BAC0638 Protein 3e-39 44
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-35 43
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 6e-29 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Emtol_3658 YP_006874811.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-43 43