Gene Information

Name : SVEN_2182 (SVEN_2182)
Accession : YP_006877727.1
Strain : Streptomyces venezuelae ATCC 10712
Genome accession: NC_018750
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein TerD
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2349642 - 2350217 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTCTCGCTGACCAAGGAGGCCCCTGGCCTCACCGCCGTGACCGTCGGTCT
GGGCTGGGACGTCCGCACCACCACCGGTACGGACTTCGACCTCGACGCCAGCGCCATCCTGGTGAGCGCGGAGGGCAAGG
TCCGCAACGACCAGGACTTCGTGTTCTTCAACAACCTGAAGAGCGCCGACGGGTCCGTCGAGCACACCGGTGACAACCTC
ACCGGCGAGGGCGAGGGTGACGACGAGCAGGTCAAGGTCAGCCTGGCCACCGTGCCGGCCGACGTCGCCAAGATCGTCTT
CCCGGTGTCGATCTACGACGCCGAGAACCGCCAGCAGTCCTTCGGCCAGGTGCGCAACGCGTTCATCCGCGTCGTGAACC
AGGCCGGCGGCGCCGAGATCGCCCGTTACGACCTCTCCGAGGACGCCTCGACCGAGACCGCCATGGTCTTCGGCGAGCTG
TACCGCAACGGCGACGAGTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCCTCGGGCCTGCGCGGCATCGCGCAGGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTAVTVGLGWDVRTTTGTDFDLDASAILVSAEGKVRNDQDFVFFNNLKSADGSVEHTGDNL
TGEGEGDDEQVKVSLATVPADVAKIVFPVSIYDAENRQQSFGQVRNAFIRVVNQAGGAEIARYDLSEDASTETAMVFGEL
YRNGDEWKFRAVGQGYASGLRGIAQDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-63 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-58 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-61 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-61 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-61 66
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-32 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-28 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SVEN_2182 YP_006877727.1 Tellurium resistance protein TerD BAC0389 Protein 1e-61 67
SVEN_2182 YP_006877727.1 Tellurium resistance protein TerD BAC0390 Protein 4e-59 64
SVEN_2182 YP_006877727.1 Tellurium resistance protein TerD BAC0392 Protein 5e-28 42