Gene Information

Name : BN115_3590 (BN115_3590)
Accession : YP_006901815.1
Strain : Bordetella bronchiseptica MO149
Genome accession: NC_018829
Putative virulence/resistance : Resistance
Product : mebrane transport protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3927255 - 3927587 bp
Length : 333 bp
Strand : +
Note : -

DNA sequence :
ATGAACAGCTGGATCTATCTGTCGGTGGCCATCGTGGCCGAAATCATCGCCACCAGCGCCCTGAAAAGCTCGGCGGGCTT
CACCCGCCTGCTCCCCTCGCTGGTCACCGTGGCGGGCTACGCGATCGCGTTCTACTTCCTGGCCCTCACGCTGCGGGTCA
TCCCGGTGGGGGTCGCCTACGCCATCTGGTCCGGCGTGGGCATCGTGCTGATCTCGCTGGTTGGCGCGCTGTTGTTCAAG
CAGCACCTGGACCTGCCCGCCATCATCGGCATCGCGCTGATCCTGGCGGGCGTGGTGGTCATGAACGTGTTCTCGAAGTC
CGTCGGCCACTGA

Protein sequence :
MNSWIYLSVAIVAEIIATSALKSSAGFTRLLPSLVTVAGYAIAFYFLALTLRVIPVGVAYAIWSGVGIVLISLVGALLFK
QHLDLPAIIGIALILAGVVVMNVFSKSVGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 4e-21 62
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-21 62
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-21 62
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-21 62
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-21 62
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-21 62
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-21 62
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-21 62
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-21 62
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 4e-21 62
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-21 62
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-21 62
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-21 62
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-21 62
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 4e-21 62
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-21 62
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-21 62
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 4e-21 62
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-21 62
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-21 62
unnamed CAD42068.1 hypothetical protein Not tested PAI II 536 Protein 1e-10 45
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 8e-14 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN115_3590 YP_006901815.1 mebrane transport protein BAC0002 Protein 7e-22 64
BN115_3590 YP_006901815.1 mebrane transport protein NC_010410.6003348.p0 Protein 7e-22 64
BN115_3590 YP_006901815.1 mebrane transport protein CP001138.1.gene1489. Protein 3e-20 62
BN115_3590 YP_006901815.1 mebrane transport protein BAC0322 Protein 1e-21 62
BN115_3590 YP_006901815.1 mebrane transport protein BAC0323 Protein 1e-21 62
BN115_3590 YP_006901815.1 mebrane transport protein BAC0324 Protein 7e-22 61
BN115_3590 YP_006901815.1 mebrane transport protein NC_002695.1.913273.p Protein 2e-16 59
BN115_3590 YP_006901815.1 mebrane transport protein BAC0150 Protein 2e-16 59
BN115_3590 YP_006901815.1 mebrane transport protein BAC0377 Protein 3e-18 54
BN115_3590 YP_006901815.1 mebrane transport protein CP004022.1.gene1549. Protein 2e-18 53
BN115_3590 YP_006901815.1 mebrane transport protein BAC0139 Protein 8e-15 47
BN115_3590 YP_006901815.1 mebrane transport protein BAC0329 Protein 9e-17 47
BN115_3590 YP_006901815.1 mebrane transport protein AE000516.2.gene3301. Protein 5e-10 46
BN115_3590 YP_006901815.1 mebrane transport protein BAC0249 Protein 5e-10 46
BN115_3590 YP_006901815.1 mebrane transport protein BAC0327 Protein 1e-16 45
BN115_3590 YP_006901815.1 mebrane transport protein BAC0325 Protein 2e-16 44
BN115_3590 YP_006901815.1 mebrane transport protein BAC0140 Protein 3e-12 44
BN115_3590 YP_006901815.1 mebrane transport protein BAC0321 Protein 8e-18 43
BN115_3590 YP_006901815.1 mebrane transport protein BAC0326 Protein 5e-16 42
BN115_3590 YP_006901815.1 mebrane transport protein BAC0216 Protein 1e-04 41
BN115_3590 YP_006901815.1 mebrane transport protein BAC0477 Protein 6e-06 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BN115_3590 YP_006901815.1 mebrane transport protein VFG1587 Protein 4e-11 45
BN115_3590 YP_006901815.1 mebrane transport protein VFG1586 Protein 3e-14 44