Gene Information

Name : DCF50_p2776 (DCF50_p2776)
Accession : YP_006914764.1
Strain : Dehalobacter sp. CF
Genome accession: NC_018867
Putative virulence/resistance : Virulence
Product : Response regulator receiver:Transcriptional regulatory protein-like protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2864670 - 2865359 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGAAAACCAGAATTCTGGTCATTGAAGATGAAGTGAAAATAGCCAGGTTCCTGGAGCTAGAGCTTGCTCATGAAGGTTA
TGAGGTAGAGCTTGCTCACGATGGAAGAGAAGGCTATGAAAAAGCAGTCTCGGGAAAGGCAGATTTGATCATTCTGGACC
TGATGCTTCCCGGCCTCAGCGGTATTGAAATCTGCCGGAGAGTAAGGCGGGTATCAGATATGCCAATTATTATGCTGACA
GCCAAAGATGATGTTTCCGACAAAGTGATGGGGCTTGATAGTGGGGCAGATGATTACATGACCAAGTCATTTGCGATAGA
AGAACTGCTAGCCAGAATCAGAGTGATCCTGAAGCGTAGAGGAAAAAAGGAAGATCAGAATAATGTGATCACGGCTGGGC
CGTTGATTTTGTTTAAGGATGAATATCGGGTTACCTATCAGGGGGTAGACATATCCCTCTCCAAGAAAGAATTTGAGCTT
CTAAAATATTTGATGGAGAATAAAGGCATTGTATTGTCGCGCGAAAAAATTCTCGACCATGTCTGGGGATATGACTACTA
TGGAGACACCAATGTCACCGATGTCTATATCAAGTACCTGCGCAATAAAATTGACCAAAAATATAATGCCGTACTGATTC
ACACCGTAAGAGGGGTCGGGTATCTTTTTAAATATGAAGACGAAAAATAA

Protein sequence :
MKTRILVIEDEVKIARFLELELAHEGYEVELAHDGREGYEKAVSGKADLIILDLMLPGLSGIEICRRVRRVSDMPIIMLT
AKDDVSDKVMGLDSGADDYMTKSFAIEELLARIRVILKRRGKKEDQNNVITAGPLILFKDEYRVTYQGVDISLSKKEFEL
LKYLMENKGIVLSREKILDHVWGYDYYGDTNVTDVYIKYLRNKIDQKYNAVLIHTVRGVGYLFKYEDEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-34 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_010079.5776364.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_002952.2859858.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_007622.3794948.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_003923.1003417.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_013450.8614146.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_002951.3238224.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_007793.3914065.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_002758.1121390.p0 Protein 4e-53 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein HE999704.1.gene1528. Protein 1e-46 54
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein AE015929.1.gene1106. Protein 5e-48 52
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein HE999704.1.gene2815. Protein 2e-44 46
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_002952.2859905.p0 Protein 7e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_013450.8614421.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_007793.3914279.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_007622.3794472.p0 Protein 7e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_002745.1124361.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_009782.5559369.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_002951.3237708.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_003923.1003749.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_002758.1121668.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_009641.5332272.p0 Protein 5e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein BAC0197 Protein 3e-39 44
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein BAC0125 Protein 2e-40 43
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein BAC0308 Protein 5e-39 43
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein BAC0111 Protein 2e-40 42
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein BAC0083 Protein 3e-39 42
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein BAC0638 Protein 6e-34 42
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein AF155139.2.orf0.gene Protein 7e-33 42
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_012469.1.7685629. Protein 4e-39 42
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein AE016830.1.gene1681. Protein 9e-41 41
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_012469.1.7686381. Protein 8e-40 41
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_014475.1.orf0.gen Protein 4e-33 41
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein NC_005054.2598277.p0 Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein VFG1390 Protein 5e-45 46
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein VFG1386 Protein 4e-42 45
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein VFG1389 Protein 6e-43 43
DCF50_p2776 YP_006914764.1 Response regulator receiver:Transcriptional regulatory protein-like protein VFG0596 Protein 1e-34 41