Gene Information

Name : yclJ (Tph_c01870)
Accession : YP_006918934.1
Strain : Thermacetogenium phaeum DSM 12270
Genome accession: NC_018870
Putative virulence/resistance : Virulence
Product : response regulator protein YclJ
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 183362 - 184042 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGGAAAGAAAGGAAAAGATCCTCATCGTTGACGACGACCGGAATATCTGCGCCCTTTTGGAGCTCTACCTGCGCCGGGA
GGGGTACAGCCTCTTCTTTGCCCACGACGGGAGCGCCGCCCTGGAGGCCTTTCGGAAGGGCAAACCTGATCTGGTCATCC
TCGACCTCATGCTGCCGGTGATCAGCGGCTGGGAGGTCTGCCGCCTGATCAGGCAGGAGAGCGACGTGCCCATCATCATG
CTCACCGCCAGGGACGCCAGTGAGGACAAGATCGCCGGCCTCGACCTGGGAGCGGACGACTACGTGGTCAAGCCCTTCGA
CCCCGGGGAGGTGGCCGCCCGGGTGCGGGCACGCCTGAGGAAAGTGAGCGGCGACGGCTCTGCGGGAAGCGTTTTCACCG
CCGGGAACCTGCGCCTCAACAGCAGGAGCTATGAAGTGACCTGCGGCGGGAAGCAGGTGGTGCTGACGCCGAAGGAGTTC
CAGCTGCTGGAGTTCATGATCCGCAATAAAAATATCGTCCTCTCCAGGGACAGGATCCTGGAAGAGGTCTGGGGGTACGA
CTACCCCGGGACGACCCGCACCGTGGACATGCACGTGAAAAAGCTGCGGGAAAAGCTGAAGCCCCCTGCCGGTTGGCGGA
TCCGGACGATCTACGGCATCGGCTACAAGTTCGAGGCTTAA

Protein sequence :
MERKEKILIVDDDRNICALLELYLRREGYSLFFAHDGSAALEAFRKGKPDLVILDLMLPVISGWEVCRLIRQESDVPIIM
LTARDASEDKIAGLDLGADDYVVKPFDPGEVAARVRARLRKVSGDGSAGSVFTAGNLRLNSRSYEVTCGGKQVVLTPKEF
QLLEFMIRNKNIVLSRDRILEEVWGYDYPGTTRTVDMHVKKLREKLKPPAGWRIRTIYGIGYKFEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-29 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_006918934.1 response regulator protein YclJ HE999704.1.gene2815. Protein 4e-38 45
yclJ YP_006918934.1 response regulator protein YclJ AE015929.1.gene1106. Protein 1e-29 44
yclJ YP_006918934.1 response regulator protein YclJ NC_007622.3794948.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_003923.1003417.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_013450.8614146.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_002951.3238224.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_007793.3914065.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_002758.1121390.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_010079.5776364.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_002952.2859858.p0 Protein 4e-33 43
yclJ YP_006918934.1 response regulator protein YclJ NC_014475.1.orf0.gen Protein 8e-34 42
yclJ YP_006918934.1 response regulator protein YclJ NC_005054.2598277.p0 Protein 8e-34 42
yclJ YP_006918934.1 response regulator protein YclJ NC_012469.1.7686381. Protein 4e-33 42
yclJ YP_006918934.1 response regulator protein YclJ NC_002952.2859905.p0 Protein 2e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_002745.1124361.p0 Protein 3e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_009782.5559369.p0 Protein 3e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_002951.3237708.p0 Protein 3e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_003923.1003749.p0 Protein 2e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_002758.1121668.p0 Protein 3e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_007622.3794472.p0 Protein 2e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_009641.5332272.p0 Protein 3e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_013450.8614421.p0 Protein 3e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_007793.3914279.p0 Protein 3e-37 42
yclJ YP_006918934.1 response regulator protein YclJ NC_012469.1.7685629. Protein 4e-36 42
yclJ YP_006918934.1 response regulator protein YclJ AE000516.2.gene3505. Protein 8e-40 42
yclJ YP_006918934.1 response regulator protein YclJ DQ212986.1.gene4.p01 Protein 1e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yclJ YP_006918934.1 response regulator protein YclJ VFG1390 Protein 4e-34 44
yclJ YP_006918934.1 response regulator protein YclJ VFG1563 Protein 3e-29 41
yclJ YP_006918934.1 response regulator protein YclJ VFG1702 Protein 2e-29 41
yclJ YP_006918934.1 response regulator protein YclJ VFG1386 Protein 1e-31 41