Gene Information

Name : yycF (Tph_c02430)
Accession : YP_006918989.1
Strain : Thermacetogenium phaeum DSM 12270
Genome accession: NC_018870
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YycF
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 240119 - 240814 bp
Length : 696 bp
Strand : -
Note : -

DNA sequence :
TTGCGTGTACTGATCGTCGAGGACGAAAGATCGCTGGTCAAGGGGCTTAAGTACGCCCTGGAAAAGGAGGGCTACCGGGT
CTCGGCCGCCTACGACGGAAAGGAGGCCCTGGAATTCCTGCGCCACAACCGGGTCGACCTGATCATCCTCGACCTGATGT
TGCCGGAGATCGACGGCCTGGAGGTCTGCCGGAGGCTGCGGCAGAGGGACAACACGCCGATCATCATGCTCACCGCCAGA
GGGGACGACGTGGACAAGATAGTCGGGCTGGAGCTGGGGGCCGACGATTACCTGGCCAAACCCTTCAACACCAGGGAGCT
GATCGCCAGGATGCGCGCCGTCCTGCGCCGCACAGCATCCTCCGCTCAGCAGCCCGGGCCTGCCCGAGGGGTGCTCACCT
TCGGCGGGCTGGAGATCGACCCCGGGCGGCGCCGGGTAACCGTTGAAGGGAGGCCGGTCGAGCTCACCGCCAGGGAATTC
GACCTCCTGCTGACGCTGGCCCGCCGCCCCGGGCTCACCTTCACCAGGGAAATGCTGCTGGACCAGGTGTGGGGGGAGGA
TTACTTCGGGGACAGCAGGGTGGTCGACGTCTACATCCGCAGGGTGCGGGAGAAGATCGAGCCCGATCCCGCCCGCCCGC
GCTGGATCATCACCAAGTGGGGAGTAGGCTATGTTTTCGCAGACGAAGAGGGGTAA

Protein sequence :
MRVLIVEDERSLVKGLKYALEKEGYRVSAAYDGKEALEFLRHNRVDLIILDLMLPEIDGLEVCRRLRQRDNTPIIMLTAR
GDDVDKIVGLELGADDYLAKPFNTRELIARMRAVLRRTASSAQQPGPARGVLTFGGLEIDPGRRRVTVEGRPVELTAREF
DLLLTLARRPGLTFTREMLLDQVWGEDYFGDSRVVDVYIRRVREKIEPDPARPRWIITKWGVGYVFADEEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-42 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-41 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_012469.1.7685629. Protein 5e-53 50
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002952.2859905.p0 Protein 7e-47 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_007622.3794472.p0 Protein 7e-47 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_009641.5332272.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_013450.8614421.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_007793.3914279.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002745.1124361.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_009782.5559369.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002951.3237708.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_003923.1003749.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002758.1121668.p0 Protein 1e-46 47
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_013450.8614146.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF AE015929.1.gene1106. Protein 2e-38 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002951.3238224.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_007793.3914065.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002758.1121390.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_010079.5776364.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002952.2859858.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_007622.3794948.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_003923.1003417.p0 Protein 2e-43 46
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_012469.1.7686381. Protein 6e-48 46
yycF YP_006918989.1 transcriptional regulatory protein YycF AE016830.1.gene1681. Protein 9e-50 46
yycF YP_006918989.1 transcriptional regulatory protein YycF HE999704.1.gene2815. Protein 1e-48 46
yycF YP_006918989.1 transcriptional regulatory protein YycF BAC0197 Protein 4e-33 45
yycF YP_006918989.1 transcriptional regulatory protein YycF AE000516.2.gene3505. Protein 1e-42 45
yycF YP_006918989.1 transcriptional regulatory protein YycF HE999704.1.gene1528. Protein 1e-37 44
yycF YP_006918989.1 transcriptional regulatory protein YycF BAC0533 Protein 4e-34 43
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_002695.1.915041.p Protein 3e-34 43
yycF YP_006918989.1 transcriptional regulatory protein YycF CP000647.1.gene4257. Protein 4e-34 43
yycF YP_006918989.1 transcriptional regulatory protein YycF CP000034.1.gene3834. Protein 3e-34 43
yycF YP_006918989.1 transcriptional regulatory protein YycF CP001138.1.gene4273. Protein 1e-34 43
yycF YP_006918989.1 transcriptional regulatory protein YycF AF155139.2.orf0.gene Protein 4e-47 43
yycF YP_006918989.1 transcriptional regulatory protein YycF CP004022.1.gene3215. Protein 6e-39 43
yycF YP_006918989.1 transcriptional regulatory protein YycF FJ349556.1.orf0.gene Protein 2e-44 43
yycF YP_006918989.1 transcriptional regulatory protein YycF CP000034.1.gene3671. Protein 1e-44 43
yycF YP_006918989.1 transcriptional regulatory protein YycF BAC0125 Protein 8e-34 42
yycF YP_006918989.1 transcriptional regulatory protein YycF NC_008702.1.4607594. Protein 5e-35 42
yycF YP_006918989.1 transcriptional regulatory protein YycF CP000675.2.gene1535. Protein 9e-38 41
yycF YP_006918989.1 transcriptional regulatory protein YycF AM180355.1.gene1830. Protein 3e-40 41
yycF YP_006918989.1 transcriptional regulatory protein YycF CP001918.1.gene5135. Protein 2e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yycF YP_006918989.1 transcriptional regulatory protein YycF VFG1389 Protein 2e-33 45
yycF YP_006918989.1 transcriptional regulatory protein YycF VFG1563 Protein 4e-42 44
yycF YP_006918989.1 transcriptional regulatory protein YycF VFG1390 Protein 7e-40 43
yycF YP_006918989.1 transcriptional regulatory protein YycF VFG1702 Protein 3e-41 43
yycF YP_006918989.1 transcriptional regulatory protein YycF VFG0596 Protein 1e-34 41
yycF YP_006918989.1 transcriptional regulatory protein YycF VFG1386 Protein 8e-35 41