Gene Information

Name : BTB_c48220 (BTB_c48220)
Accession : YP_006929438.1
Strain : Bacillus thuringiensis Bt407
Genome accession: NC_018877
Putative virulence/resistance : Virulence
Product : Two-component response regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4663833 - 4664531 bp
Length : 699 bp
Strand : -
Note : -

DNA sequence :
GTGAGTAAATTGAAAAGAATTTTACTAATAGAAGATGAAGTAAGTATTGCAGAATTACAGCGAGATTATTTAGAAATTAA
TGATTTCCAAGTTGATGTAGAGCATTCAGGAGAAACAGGTTTACAAATAGCCCTGCAAGAAGAATATGATTTAATTATTT
TAGATATTATGCTCCCGAAAATGAACGGATTCGAAATTTGTAAACAAATACGTGCTGTAAAAGATATTCCGATTCTACTT
GTTTCAGCAAAAAAAGAAGATATAGATAAAATTCGCGGACTCGGATTAGGAGCGGATGATTATATAACGAAACCGTTTAG
CCCAAGCGAATTAGTCGCAAGAGTAAAAGCTCATATTGCTCGTTATGAAAGATTATCAGGAAATGTAAGTAAGCAACGTG
ATACGTTATATATTCACGGAATTTCTATCGATCAACGAGCGAGGAAAGTTTTTATAAACAATGAAGAAGTGGCATTTACA
ACGAAGGAATTTGATTTATTAACATTCTTTGTCACACATCCAAACCAAGTATTAAATAAAGAACAGTTATTTGAACGCAT
TTGGGGATTAGATTCCGCTGGTGATTTAGCCACTGTTGTCGTCCACATTAGAAAGCTACGTGAAAAAATTGAAAGAGATC
CTGCCCACCCACAATATATTGAAACAGTATGGGGAGCTGGTTATCGTTTTAATGTGTAG

Protein sequence :
MSKLKRILLIEDEVSIAELQRDYLEINDFQVDVEHSGETGLQIALQEEYDLIILDIMLPKMNGFEICKQIRAVKDIPILL
VSAKKEDIDKIRGLGLGADDYITKPFSPSELVARVKAHIARYERLSGNVSKQRDTLYIHGISIDQRARKVFINNEEVAFT
TKEFDLLTFFVTHPNQVLNKEQLFERIWGLDSAGDLATVVVHIRKLREKIERDPAHPQYIETVWGAGYRFNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-43 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-42 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTB_c48220 YP_006929438.1 Two-component response regulator AE016830.1.gene1681. Protein 1e-46 46
BTB_c48220 YP_006929438.1 Two-component response regulator NC_012469.1.7686381. Protein 7e-40 44
BTB_c48220 YP_006929438.1 Two-component response regulator FJ349556.1.orf0.gene Protein 1e-43 44
BTB_c48220 YP_006929438.1 Two-component response regulator AM180355.1.gene1830. Protein 4e-40 43
BTB_c48220 YP_006929438.1 Two-component response regulator AE015929.1.gene1106. Protein 4e-33 42
BTB_c48220 YP_006929438.1 Two-component response regulator HE999704.1.gene2815. Protein 3e-41 42
BTB_c48220 YP_006929438.1 Two-component response regulator AF155139.2.orf0.gene Protein 5e-44 42
BTB_c48220 YP_006929438.1 Two-component response regulator NC_002951.3238224.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_007793.3914065.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_002758.1121390.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_010079.5776364.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_002952.2859858.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_007622.3794948.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_003923.1003417.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_013450.8614146.p0 Protein 8e-37 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_002952.2859905.p0 Protein 3e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_002745.1124361.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_009782.5559369.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_002951.3237708.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_003923.1003749.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_002758.1121668.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_009641.5332272.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_013450.8614421.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator AF130997.1.orf0.gene Protein 2e-36 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_007793.3914279.p0 Protein 4e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator NC_007622.3794472.p0 Protein 3e-41 41
BTB_c48220 YP_006929438.1 Two-component response regulator EU250284.1.orf4.gene Protein 3e-40 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BTB_c48220 YP_006929438.1 Two-component response regulator VFG1563 Protein 8e-44 41
BTB_c48220 YP_006929438.1 Two-component response regulator VFG1702 Protein 1e-42 41