Gene Information

Name : yceD (BN424_3536)
Accession : YP_006994270.2
Strain : Carnobacterium maltaromaticum LMA28
Genome accession: NC_019425
Putative virulence/resistance : Resistance
Product : general stress protein 16U
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3521436 - 3522017 bp
Length : 582 bp
Strand : -
Note : [T] COG2310 Uncharacterized proteins involved in stress response, homologs of TerZ and putative cAMP-binding protein CABP1

DNA sequence :
ATGGCAGTATCATTAGCAAAAGGTCAAAAAGTTGATTTAACAAAAAATAACCCAGGTTTAAAAACGGTGCGTGTTGGTTT
AGGCTGGGATACCAATAAATATGATGGTCAAGGCGATTTCGATTTAGATGCAGAAGTATTTTTACTTGCAGCAAATGAAA
AAGTGAAAAGCGACGCAGATTTTATTTTTTATAACCAACCAACAAGCCCAGATGGAGCCGTGCAACATTTAGGTGATAAC
CGAACTGGTGAAGGCGATGGTGACGATGAATCGGTGACTGTTGAATTAGGTAAAGTAGATTCTGCCATCGAAAAAATTCG
TTTCACAGTAACAATTGATAGCGCTGATGAGCGAAACCAAAATTTTGGTCAAGTATCAAATGCCTTCATTCGTATTTTAA
ATGCAGACAACGAAGAAGAATTGATTCGCTATGATTTAGGCGAAGATTTTTCAATTGAAACAGCAATTGTTGTTGGAGAA
TTGTACCGTCATAATGGCGAGTGGAAATTTACAGCAATCGGTAGTGGGTATCAAGGTGGACTAGCTGCATTAGGTCGTGA
CTTTGGTGTGAATATCGGGTAA

Protein sequence :
MAVSLAKGQKVDLTKNNPGLKTVRVGLGWDTNKYDGQGDFDLDAEVFLLAANEKVKSDADFIFYNQPTSPDGAVQHLGDN
RTGEGDGDDESVTVELGKVDSAIEKIRFTVTIDSADERNQNFGQVSNAFIRILNADNEEELIRYDLGEDFSIETAIVVGE
LYRHNGEWKFTAIGSGYQGGLAALGRDFGVNIG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-54 62
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-54 62
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-53 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-51 60
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-50 60
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-50 60
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-54 59
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-49 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceD YP_006994270.2 general stress protein 16U BAC0390 Protein 5e-54 61
yceD YP_006994270.2 general stress protein 16U BAC0389 Protein 2e-53 61