Gene Information

Name : ANA_C20187 (ANA_C20187)
Accession : YP_007000699.1
Strain :
Genome accession: NC_019439
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 217731 - 218306 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGCAGTTTCGCTAACTAAAGGACAACGGATATCACTGGAAAAAGTCGCCCCAGGACTTACCGAAGTATTTGTGGGTTT
AGGGTGGGATGTTAAAGTTGTGGATACTGGCTTGGATTTTGACTTGGATGCCTCCGTCTTTATCCTGGGAAGTAACGAAA
AACTAATTTCTGATCAACACTTCATTTTTTACAATAATCTTACCAGTCCAGATCCTGCTAAATCAGTTCAACACACCGGA
GATAACCTGACAGGTTTAGGTGATGGTGATGATGAAGTCATTAAAATTCATTTGCAAAAAGTCCCTGCGGATGTCCACAA
AATTGTCATCGCTGTTACTATTCATGAAGCAGCAGAACGGCATCAAAACTTTGGTCAAGTGCAAAATGCCTTTATTCGGG
TTGTAAATGCTCAAAACGAACAAGAAGTTATTCGCTATGATTTAGTTGAAGACTACTCCACTGAAACTGCCTTAATTATG
GCTGAACTTTACCGTAAAGACGGAGATTGGCGGTTAAATGCCGTTGGTTCAGGCTATCAAGGAGGATTGAAAGCTTTATT
AGATCGCTTTAGCTAG

Protein sequence :
MAVSLTKGQRISLEKVAPGLTEVFVGLGWDVKVVDTGLDFDLDASVFILGSNEKLISDQHFIFYNNLTSPDPAKSVQHTG
DNLTGLGDGDDEVIKIHLQKVPADVHKIVIAVTIHEAAERHQNFGQVQNAFIRVVNAQNEQEVIRYDLVEDYSTETALIM
AELYRKDGDWRLNAVGSGYQGGLKALLDRFS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-47 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 59
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-45 59
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-41 59
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-41 59
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-41 59
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-45 58
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-42 57
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-22 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANA_C20187 YP_007000699.1 stress protein BAC0390 Protein 4e-45 62
ANA_C20187 YP_007000699.1 stress protein BAC0389 Protein 5e-45 58