Gene Information

Name : ANA_C20188 (ANA_C20188)
Accession : YP_007000700.1
Strain :
Genome accession: NC_019439
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 218319 - 218924 bp
Length : 606 bp
Strand : +
Note : -

DNA sequence :
ATGGCAATTAATCTCCAGAAAGGACAAAGAATTTCCCTTTCTAAAGAAGCTCCTGGTCTAACCAAATTGATGTGTGGATT
GGGCTGGGATGTAGTTAAACGCTCTGGTGGCGGATTTTTTAGAAGTTTTGGTGGTGGTGGTCATGAATATGATCTAGATG
CCTCTGTAGTTTGCTTGGATGCTAATGGTAAATTAACAGCCCAAGAAAACATTATCTATTTTGGGAATCTTCAACATTTA
TCAGGATCAATCGTCCATACAGGAGACAATTTAACTGGTGCTGGTGATGGTGATGACGAAGTAATCATTATTGATTTACC
TCGCATTCCTGCTGATATTGCTAAATTAGTCTTCGTCATCAATATTTACGATTGTATTGCTCGTAAACAAGATTTTACCC
AAGTTGACAATGCCTTTGTTAGATTGGTAAATGCAGCTAATAATAAAGAATTAGCTCGATATAATCTTTCTGGGAAAGAG
TATAGCGGCATGACAGGAATGGTTTTAGCTGAAGTTTATCGCCACAATAACGAGTGGAAAATGGCAGCTATTGGGAATGG
TGTGAGTGTTAATGGCTTAGGGGAACTTGTTGCATCTTATTGTTAA

Protein sequence :
MAINLQKGQRISLSKEAPGLTKLMCGLGWDVVKRSGGGFFRSFGGGGHEYDLDASVVCLDANGKLTAQENIIYFGNLQHL
SGSIVHTGDNLTGAGDGDDEVIIIDLPRIPADIAKLVFVINIYDCIARKQDFTQVDNAFVRLVNAANNKELARYNLSGKE
YSGMTGMVLAEVYRHNNEWKMAAIGNGVSVNGLGELVASYC

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-41 47
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-34 47
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-36 45
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-36 45
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-36 45
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-28 45
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-37 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-37 44
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-37 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ANA_C20188 YP_007000700.1 stress protein BAC0389 Protein 3e-37 44
ANA_C20188 YP_007000700.1 stress protein BAC0390 Protein 3e-35 42
ANA_C20188 YP_007000700.1 stress protein BAC0392 Protein 1e-26 41