Gene Information

Name : czcR (PputUW4_02047)
Accession : YP_007029055.1
Strain : Pseudomonas sp. UW4
Genome accession: NC_019670
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2383915 - 2384586 bp
Length : 672 bp
Strand : -
Note : [TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAACATCCTCGTAGTCGAAGACGAACCCAAGGCCGGCAATTACCTGCTCAACGGCCTGCAGGAACTCGGATACACCGT
GAACCTGGCGCGCGACGGCGTCGATGGCCTGCACCTGGCCCTGGAACACGACTTCGATGTAATCGTGCTGGACGTCATGA
TGCCGAAGATGGATGGCTGGGAAGTCCTGCGCCGCCTGCGCAAGGAAGCCGACACACCGGTGCTGTTCCTCACCGCCCGG
GATGACATCGCCGACCGCATCAAAGGCCTCGAACTGGGCGCCGACGATTACCTGATCAAACCCTTTTCCTTCGCCGAACT
GGTGGCGCGCCTGCGCACCCTGACCCGCCGTGGCCCTACCCGGGAAGACGAACACCTGCACGTCGACGACCTGCAGATCG
ACGTGCTCAAGCGTCGCGTCAGCCGCGCCGGCAACCGCATCACCCTGACCAACAAGGAATTTGCCCTGCTGCACCTGTTC
GCCACGCATCAGGGCGAAGTGCTGTCACGCTCGATGATCGCCTCGCGGGTCTGGGACATGAATTTCGACAGCGACACCAA
TGTCGTCGATGTCGCGGTGCGCCGCCTGCGCCTGAAAATCGACGACCCGTTCCAGCTCAAGCTGATCCACAGCGTGCGCG
GCATCGGCTATCGCTTCGACACTCAACCTTGA

Protein sequence :
MNILVVEDEPKAGNYLLNGLQELGYTVNLARDGVDGLHLALEHDFDVIVLDVMMPKMDGWEVLRRLRKEADTPVLFLTAR
DDIADRIKGLELGADDYLIKPFSFAELVARLRTLTRRGPTREDEHLHVDDLQIDVLKRRVSRAGNRITLTNKEFALLHLF
ATHQGEVLSRSMIASRVWDMNFDSDTNVVDVAVRRLRLKIDDPFQLKLIHSVRGIGYRFDTQP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-55 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-54 51

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_007029055.1 two component heavy metal response transcriptional regulator BAC0125 Protein 4e-66 62
czcR YP_007029055.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-55 61
czcR YP_007029055.1 two component heavy metal response transcriptional regulator BAC0083 Protein 2e-63 60
czcR YP_007029055.1 two component heavy metal response transcriptional regulator BAC0197 Protein 6e-62 59
czcR YP_007029055.1 two component heavy metal response transcriptional regulator BAC0111 Protein 2e-60 57
czcR YP_007029055.1 two component heavy metal response transcriptional regulator BAC0308 Protein 3e-54 56
czcR YP_007029055.1 two component heavy metal response transcriptional regulator BAC0347 Protein 5e-54 54
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 6e-34 42
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 6e-34 42
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 6e-34 42
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 6e-34 42
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 6e-34 42
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 6e-34 42
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 6e-34 42
czcR YP_007029055.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 6e-34 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_007029055.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-55 54
czcR YP_007029055.1 two component heavy metal response transcriptional regulator VFG1386 Protein 3e-34 45
czcR YP_007029055.1 two component heavy metal response transcriptional regulator VFG1390 Protein 3e-36 44
czcR YP_007029055.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-30 43