Gene Information

Name : Nos7107_2779 (Nos7107_2779)
Accession : YP_007050527.1
Strain : Nostoc sp. PCC 7107
Genome accession: NC_019676
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3227673 - 3228356 bp
Length : 684 bp
Strand : +
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_3453 t

DNA sequence :
GTGAACGTTCTGTTTGTCGAAGATGAAGCAAAAATTGCTAACTTCGTCCGGGCTGGACTGAAGGAACAGGGTTTTGTCGT
AGACTATTGCGACAACGGTGATGATGGATATCTGCGAGCAATGGATAACGAATATGATGCCATTATTCTGGACATTATGG
TGCCAGGAAAGGATGGTTTATCAATTCTCAAACAACTACGACGGGAAGGGCGGAATGCTCCCGTAATTTTGTTAACGGCT
CGCAATGAACTAGACGATCGCCTCGCTGGTTTAAACTTGGGAGCCGATGATTACATTGCTAAACCCTTTTTTGTGGAAGA
ATTAGCGGCGCGGATTCATGCGGTGGTGCGTCGGAGTGTAGGCGATCGCCAAAATTTGCTGGCGGTTGGATCAATCAAAC
TTGATCGCATCACGAGGGAAGTGACTTGCAATCAAAGCGCTATAGAACTTACTAGCCGCGAGTTTAATCTACTGGAATAT
CTTATGCGCTCTCCTGGTCGAGTGTTCACCCGTACCCAAATCTTAGAACACATTTGGGGTTATGATTTTAACCCCAATAC
TAACGTTGTGGATGTCTGCATTCAGCGCATTCGCAAAAAAATTGACCCGATAGATGAAACAAATTGGATTGAAAGCATTC
GCGGCGTGGGCTATCGGTTTCGCAAACCAGACAATCAATCGTGA

Protein sequence :
MNVLFVEDEAKIANFVRAGLKEQGFVVDYCDNGDDGYLRAMDNEYDAIILDIMVPGKDGLSILKQLRREGRNAPVILLTA
RNELDDRLAGLNLGADDYIAKPFFVEELAARIHAVVRRSVGDRQNLLAVGSIKLDRITREVTCNQSAIELTSREFNLLEY
LMRSPGRVFTRTQILEHIWGYDFNPNTNVVDVCIQRIRKKIDPIDETNWIESIRGVGYRFRKPDNQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-38 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-42 45
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-44 45
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-45 44
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator BAC0347 Protein 1e-41 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-34 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-38 43
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-42 42
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-36 41
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-39 42
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-41 42
Nos7107_2779 YP_007050527.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-34 41