Gene Information

Name : Nos7107_3591 (Nos7107_3591)
Accession : YP_007051309.1
Strain : Nostoc sp. PCC 7107
Genome accession: NC_019676
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4172537 - 4173247 bp
Length : 711 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal; COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: ava:Ava_1944 t

DNA sequence :
ATGGAAATTTTAATTGTTGAGGATGAATCTGAAATTGCTCAGTTAATCCAACTGTCTTTAGAAAAAGAAGGATTTTCTTG
TCGTGTTGGCCGCGATGGTGTGAACGCTTTGCGGATGTTTCAGGAGCAACCGCCTGATTTAATCATTCTAGATTTAATGA
TTCCTGGGTTGGATGGATTAGAGGTTTGTGCCAGAATTCGGCAAAAACCAGGTACAAAAGACCCTTATATTTTGATGTTG
ACAGCCAAGGGTGAAGAAATCGATCGCGTCATTGGCTTATCTACTGGTGCTGATGACTACATGGTTAAACCTTTCAGCCC
TAGAGAGTTAGTAGCTAGAGTGCGGGCGTTATTGCGGCGTAGTCTCCGCCAAGGCGGACAACATCAAGTCACGCGGACAC
AAAACTTTATCGTAGATGTAGAACAACGCACGGCTTCTCGCCAGTTAAATTCTCAAGAAGCAGAAACTTTAGATTTAACA
AACTTGGAATTTAACTTATTAAGTACCTTTGTCAGTAATCCTGGGCGAGTTTGGAACCGTACCCAGCTAATTGATAAACT
CTGGGGAGATGATTTTTTTGGTGACGAGCGAGTTGTTGACACCCATGTAGCGCGGTTGCGGAAAAAAATTGAGCCTGACC
CAGCTAATCCCTTATTTATTAAAACTGTTGTGGGAGTTGGCTATAAATTTGAAGACTCTGCTGTAACGTGA

Protein sequence :
MEILIVEDESEIAQLIQLSLEKEGFSCRVGRDGVNALRMFQEQPPDLIILDLMIPGLDGLEVCARIRQKPGTKDPYILML
TAKGEEIDRVIGLSTGADDYMVKPFSPRELVARVRALLRRSLRQGGQHQVTRTQNFIVDVEQRTASRQLNSQEAETLDLT
NLEFNLLSTFVSNPGRVWNRTQLIDKLWGDDFFGDERVVDTHVARLRKKIEPDPANPLFIKTVVGVGYKFEDSAVT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-27 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 5e-32 44
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 5e-32 44
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-31 44
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-35 44
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-36 44
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 9e-30 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator BAC0039 Protein 5e-30 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-30 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-29 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 5e-30 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 5e-30 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-29 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-34 43
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-35 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 7e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-27 41
Nos7107_3591 YP_007051309.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-27 41