Gene Information

Name : Riv7116_5064 (Riv7116_5064)
Accession : YP_007058009.1
Strain : Rivularia sp. PCC 7116
Genome accession: NC_019678
Putative virulence/resistance : Virulence
Product : response regulator with CheY-like receiver domain and winged-helix DNA-binding domain
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 6344014 - 6344694 bp
Length : 681 bp
Strand : -
Note : PFAM: Response regulator receiver domain; Transcriptional regulatory protein, C terminal

DNA sequence :
ATGAGTGAAAACATTATTCTGGTTGAAGATGAAGTCAAATTAGCTCAATTTTTAGAAATGGAGTTGAGTAGCGAAGGTTA
TAACGTTAGCGTCGCTCATGACGGAATGACAGGATTGATTTTAGCGCGAGAATCAACTCCTGATTTAGCAATTTTAGATT
GGATGCTTCCCGGTTTAAGTGGGGTGGAGCTTTGTCGTCGTCTGCGAACAACAGGAAGTAAAATTCCAATAATTTTACTA
ACTGCTAAGGATGAAGTAACTGCACGGGTTGAAGGTTTGGATGCTGGGGCTGATGATTATGTAATCAAACCTTTTAGTAT
AGAAGAACTTTTAGCTAGAATTCGCGCTCATTTACGTCGTTGTACTGAGGAAGATAATCGTCATTTATTACAATTTGAAG
ATTTGAGCTTAAATCGTCAAACTCGTCAGGTTTTTCGCGGTGATAGAGCAATAGAGTTGACGGTAAAAGAGTTTGATTTG
CTCGAATATTTGATGGGAAATCCCCGTCAAGTGTTTACAAGAGACCAAATTTTAGAAAAGGTTTGGGGTTATGATTTTGT
TGGCGATTCTAATGTTATTGAAGTGTATGTCCGTTATGTACGTCTCAAACTTGAAGAAAACAACGAAAAACGTTTGGTTC
ATACAGTGCGCGGTGTCGGCTATGTTTTGCGCGAAGAATGA

Protein sequence :
MSENIILVEDEVKLAQFLEMELSSEGYNVSVAHDGMTGLILARESTPDLAILDWMLPGLSGVELCRRLRTTGSKIPIILL
TAKDEVTARVEGLDAGADDYVIKPFSIEELLARIRAHLRRCTEEDNRHLLQFEDLSLNRQTRQVFRGDRAIELTVKEFDL
LEYLMGNPRQVFTRDQILEKVWGYDFVGDSNVIEVYVRYVRLKLEENNEKRLVHTVRGVGYVLREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-34 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003417.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614146.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3238224.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE015929.1.gene1106. Protein 1e-42 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914065.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121390.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_010079.5776364.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859858.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794948.p0 Protein 4e-46 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain HE999704.1.gene1528. Protein 1e-44 47
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain AE000516.2.gene3505. Protein 1e-39 45
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0125 Protein 8e-41 44
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0083 Protein 3e-40 44
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0308 Protein 4e-37 43
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0197 Protein 1e-34 43
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0347 Protein 5e-38 42
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0288 Protein 7e-32 42
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0111 Protein 4e-39 42
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain BAC0638 Protein 8e-35 42
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002952.2859905.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002951.3237708.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002758.1121668.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009641.5332272.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_013450.8614421.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007793.3914279.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_003923.1003749.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_007622.3794472.p0 Protein 9e-40 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_002745.1124361.p0 Protein 1e-39 41
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain NC_009782.5559369.p0 Protein 1e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1390 Protein 2e-54 54
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1386 Protein 2e-45 44
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG0596 Protein 5e-35 43
Riv7116_5064 YP_007058009.1 response regulator with CheY-like receiver domain and winged-helix DNA-binding domain VFG1389 Protein 3e-40 43